Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF COUR FROM RHODOCOCCUS JOSTII RHA1 BOUND TO P-COUMAROYL-COA
 
Authors :  P. J. Stogios, X. Xu, A. Dong, A. Savchenko, A. Joachimiak, Midwest Cen Structural Genomics (Mcsg)
Date :  30 Jul 15  (Deposition) - 12 Aug 15  (Release) - 23 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.52
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transcription Regulator, P-Hydroxycinnamate Metabolism, Mcsg, Pf04017, Psi-Biology, Marr, Structural Genomics, Protein Structure Initiative, Midwest Center For Structural Genomics, Transcriptional Regulator (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Otani, P. J. Stogios, X. Xu, B. Nocek, S. N. Li, A. Savchenko, L. D. Eltis
The Activity Of Cour, A Marr Family Transcriptional Regulator, Is Modulated Through A Novel Molecular Mechanism
Nucleic Acids Res. V. 44 595 2016
PubMed-ID: 26400178  |  Reference-DOI: 10.1093/NAR/GKV955

(-) Compounds

Molecule 1 - TRANSCRIPTIONAL REGULATOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P15TV-LIC
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RHA1_RO05125
    Organism Scientific: RHODOCOCCUS JOSTII (STRAIN RHA1)
    Organism Taxid: 101510
    Strain: RHA1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 9)

Asymmetric/Biological Unit (4, 9)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2CL3Ligand/IonCHLORIDE ION
3MG3Ligand/IonMAGNESIUM ION
4WCA2Ligand/IonP-COUMAROYL-COA

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:78 , HOH A:361binding site for residue MG A 201
2AC2SOFTWAREWCA B:201 , HOH B:370 , HOH B:415 , HOH B:427 , HOH B:523binding site for residue MG A 202
3AC3SOFTWAREWCA B:201 , WCA B:202 , HOH B:349 , HOH B:371 , HOH B:378binding site for residue MG A 203
4AC4SOFTWAREARG A:36 , WCA B:202binding site for residue ACT A 204
5AC5SOFTWAREARG A:38binding site for residue CL A 205
6AC6SOFTWAREARG A:38 , HOH A:342 , HOH A:494binding site for residue CL A 206
7AC7SOFTWAREVAL A:22 , LEU A:23 , VAL A:37 , ARG A:38 , SER A:41 , MET A:62 , VAL A:113 , HIS A:117 , MG A:202 , MG A:203 , ASP B:10 , GLY B:12 , PHE B:13 , SER B:16 , GLY B:20 , LEU B:23 , ARG B:36 , WCA B:202 , HOH B:333 , HOH B:346 , HOH B:347 , HOH B:352 , HOH B:353 , HOH B:367 , HOH B:368 , HOH B:369 , HOH B:370 , HOH B:371 , HOH B:378 , HOH B:392 , HOH B:394 , HOH B:396 , HOH B:404 , HOH B:409 , HOH B:411 , HOH B:415 , HOH B:418 , HOH B:422 , HOH B:427 , HOH B:437 , HOH B:439binding site for residue WCA B 201
8AC8SOFTWAREPHE A:13 , SER A:16 , ARG A:17 , GLY A:20 , LEU A:23 , GLY A:24 , ASN A:27 , LYS A:28 , VAL A:31 , ARG A:36 , MG A:203 , ACT A:204 , HOH A:327 , LEU B:23 , VAL B:37 , ARG B:38 , SER B:41 , MET B:62 , VAL B:113 , HIS B:117 , WCA B:201 , HOH B:305 , HOH B:321 , HOH B:333 , HOH B:348 , HOH B:349 , HOH B:368 , HOH B:371 , HOH B:378 , HOH B:414 , HOH B:431 , HOH B:453binding site for residue WCA B 202
9AC9SOFTWAREGLN B:55 , ARG B:84 , HOH B:527binding site for residue CL B 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CYV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CYV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CYV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CYV)

(-) Exons   (0, 0)

(no "Exon" information available for 5CYV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:138
                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh....eehhhhhhhhh.hhhhhhhhhhhhhhh..eeee....eeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cyv A   4 SQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFVE 146
                                    13        23        33        43        53        63        73        83  ||    98       108       118       128       138        
                                                                                                             86|                                                      
                                                                                                              92                                                      


Chain B from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeee..eeeeeeeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cyv B   4 SQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLDPSDRRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFVE 146
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CYV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CYV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CYV)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    WCA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5cyv)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cyv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0S6D0_RHOJR | Q0S6D0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q0S6D0_RHOJR | Q0S6D0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q0S6D0_RHOJR | Q0S6D0: 3fm5

(-) Related Entries Specified in the PDB File

3fm5 LIGAND-FREE FORM RELATED ID: MCSG-APC5972 RELATED DB: TARGETTRACK