Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF N-TERMINAL DOMAIN TRUNCATED TRYPANOSOMA CRUZI VACUOLAR SOLUBLE PYROPHOSPHATASES IN COMPLEX WITH PPI
 
Authors :  W. D. Liu, Y. Y. Yang, T. P. Ko, Y. Y. Zheng, C. C. Chen, R. T. Guo
Date :  25 Jul 15  (Deposition) - 02 Mar 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Substrate Binding, Acidocalcisomal Pyrophosphatase, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Y. Yang, T. P. Ko, Y. Y. Zheng, W. D. Liu, C. C. Chen, R. T. Guo
Crystal Structure Of Trypanosoma Cruzi Protein In Complex With Ligand
Acs Chem. Biol. 2016
PubMed: search

(-) Compounds

Molecule 1 - ACIDOCALCISOMAL PYROPHOSPHATASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET46
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 147-408
    Organism Scientific: TRYPANOSOMA CRUZI
    Organism Taxid: 5693

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric Unit (2, 10)
No.NameCountTypeFull Name
1PO47Ligand/IonPHOSPHATE ION
2POP3Ligand/IonPYROPHOSPHATE 2-
Biological Unit 1 (2, 20)
No.NameCountTypeFull Name
1PO414Ligand/IonPHOSPHATE ION
2POP6Ligand/IonPYROPHOSPHATE 2-

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:213 , LYS A:215 , LEU A:219 , PRO A:220 , MET A:221 , ASN A:222 , ARG A:223 , HOH A:908binding site for residue POP A 801
02AC2SOFTWARELYS A:237 , ARG A:259 , ASP A:323 , TYR A:368 , LYS A:369 , PO4 A:805 , HOH A:916binding site for residue POP A 802
03AC3SOFTWARETHR A:214 , LYS A:215 , GLY B:311 , ALA B:312 , ASN B:337binding site for residue PO4 A 803
04AC4SOFTWAREPRO A:351 , GLY A:356 , ASP A:359 , HOH A:907binding site for residue PO4 A 804
05AC5SOFTWAREASP A:324 , LYS A:369 , POP A:802binding site for residue PO4 A 805
06AC6SOFTWARETYR A:207 , ARG A:209 , HIS A:399binding site for residue PO4 A 806
07AC7SOFTWAREARG B:213 , LYS B:215 , LEU B:219 , PRO B:220 , MET B:221 , ASN B:222 , HIS B:336 , HOH B:603binding site for residue POP B 501
08AC8SOFTWAREGLY A:311 , ALA A:312 , ASN A:337 , THR B:214 , LYS B:215 , HOH B:608binding site for residue PO4 B 502
09AC9SOFTWAREARG B:259 , ASP B:323 , TYR B:368 , LYS B:369 , PO4 B:504binding site for residue PO4 B 503
10AD1SOFTWAREASP B:324 , LYS B:369 , PO4 B:503 , HOH B:607binding site for residue PO4 B 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CUX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CUX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CUX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CUX)

(-) Exons   (0, 0)

(no "Exon" information available for 5CUX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:263
                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................eeeeeeee........eeeeeeee.....eeee.............ee..........eeeeeee.......eee........eee.................eeeee.........eehhhee.....eeeee..........eeeeeeeeeeeeee..eeeeeeeeee....hhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhh.eeehhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cux A 146 MAKKDFFSMVSVDFAVPYHQQQLLTRETGELYTPSYRVLYYFRDMETGKELQVSPWHDIPLYVRDLVRTKPASLPMNRYNFICEIPKWTRAKFEIATGEPFNPIKQDIKNGVPRFYKHGDMMWNYGALPQTWESTDVVFEGGYVGDNDPIDAIEIGMTQFKVGQVGAVKVLGILGMIDDGQMDWKVICISHNDPICRFLKDIHDVPKFLPGCLDAIHEWFRVYKICQGGVENKFVFNGEFKDKSFAMKVIDESHYMWGNLRKI 408
                                   155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405   


Chain B from PDB  Type:PROTEIN  Length:257
                                                                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeeeee........eeeeeeee.....eeee.............ee..........eeeeeee.......eee........eee.................eeee..........eehhhee......eeee..........eeeeeeeeeeeeee..eeeeeeeeee..........hhhhhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhh.eeehhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cux B 152 FSMVSVDFAVPYHQQQLLTRETGELYTPSYRVLYYFRDMETGKELQVSPWHDIPLYVRDLVRTKPASLPMNRYNFICEIPKWTRAKFEIATGEPFNPIKQDIKNGVPRFYKHGDMMWNYGALPQTWESTDVVFEGGYVGDNDPIDAIEIGMTQFKVGQVGAVKVLGILGMIDDGQMDWKVICISHNDPICRFLKDIHDVPKFLPGCLDAIHEWFRVYKICQGGVENKFVFNGEFKDKSFAMKVIDESHYMWGNLRKI 408
                                   161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CUX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CUX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CUX)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    POP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5cux)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cux
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4JH30_TRYCR | Q4JH30
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q4JH30_TRYCR | Q4JH30
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4JH30_TRYCR | Q4JH30: 5cuu 5cuv

(-) Related Entries Specified in the PDB File

5cuu 5cuv 5cuy