Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI VACUOLAR SOLUBLE PYROPHOSPHATASES IN COMPLEX WITH BISPHOSPHONATE INHIBITOR BPH-1260
 
Authors :  W. D. Liu, Y. Y. Yang, T. P. Ko, Y. Y. Zheng, C. C. Chen, R. T. Guo
Date :  25 Jul 15  (Deposition) - 02 Mar 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.96
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Substrate Binding, Acidocalcisomal Pyrophosphatase, Inhibitor, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Y. Yang, T. P. Ko, Y. Y. Zheng, W. D. Liu, C. C. Chen, R. T. Guo
Crystal Structure Of Trypanosoma Cruzi Protein In Complex With Ligand
Acs Chem. Biol. 2016
PubMed: search

(-) Compounds

Molecule 1 - ACIDOCALCISOMAL PYROPHOSPHATASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET46
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 32-410
    Organism ScientificTRYPANOSOMA CRUZI
    Organism Taxid5693

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric Unit (3, 7)
No.NameCountTypeFull Name
14GA2Ligand/Ion1-BUTYL-3-(2-HYDROXY-2,2-DIPHOSPHONOETHYL)-1H-IMIDAZOL-3-IUM
2MG2Ligand/IonMAGNESIUM ION
3MLT3Ligand/IonD-MALATE
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
14GA4Ligand/Ion1-BUTYL-3-(2-HYDROXY-2,2-DIPHOSPHONOETHYL)-1H-IMIDAZOL-3-IUM
2MG-1Ligand/IonMAGNESIUM ION
3MLT6Ligand/IonD-MALATE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:213 , LYS A:215 , MET A:221 , ASN A:222 , ARG A:223 , HIS A:336binding site for residue MLT A 901
2AC2SOFTWARELYS A:215 , ARG A:223 , HIS A:336 , ASN A:337 , HOH A:1002 , ARG B:223binding site for residue MLT A 902
3AC3SOFTWARELYS A:237 , TYR A:261 , ASP A:323 , TYR A:368 , LYS A:369 , MG A:904binding site for residue DRG A 903
4AC4SOFTWAREASP A:324binding site for residue MG A 904
5AC5SOFTWAREARG B:213 , LYS B:215 , LEU B:219 , MET B:221 , ASN B:222 , ARG B:223 , HIS B:336binding site for residue MLT B 901
6AC6SOFTWARELYS B:237 , TYR B:261 , ASP B:323 , TYR B:368 , LYS B:369 , MG B:903binding site for residue DRG B 902

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CUU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CUU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CUU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CUU)

(-) Exons   (0, 0)

(no "Exon" information available for 5CUU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:378
                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................hhhhhh...hhhhhhhhh....hhhhhhhhhhhhhhhhh......ee.hhhhhhhhhh....hhhhhhhhhhhhh....eehhhhhhhhhh......hhhhh..............eeeeeeee........eeeeeeee.....eeeehhhhhh.......ee..........eeeeeee.......eee........eee.ee..ee..........eeee..........ee...eee.....eeee..........eeeeeeeeeeeeee..eeeeeeeeee....hhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhhh.eehhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cuu A  33 NSYIGTGLDTSLENVKPLPEACKRNVTEFDLVAYGKDEFTLSMEKRVMARMFSAFDVTQLGYLEERKIEHMCKYLGRVMNEDDVKQMKSEINAIDGHITFEKFWAWWCSHPEVPAKKDFFSMVSVDFAVPYHQQQLLTRETGELYTPSYRVLYYFRDMETGKELQVSPWHDIPLYVRDLVRTKPASLPMNRYNFICEIPKWTRAKFEIATGEPFNPIKQDIKNGVPRFYKHGDMMWNYGALPQTWESTDVVFEGGYVGDNDPIDAIEIGMTQFKVGQVGAVKVLGILGMIDDGQMDWKVICISHNDPICRFLKDIHDVPKFLPGCLDAIHEWFRVYKICQGGVENKFVFNGEFKDKSFAMKVIDESHYMWGNLRKINK 410
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402        

Chain B from PDB  Type:PROTEIN  Length:379
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhh.hhhhhhhhh....hhhhhhhhhhhhhhh........ee.hhhhhhhhhh....hhhhhhhhhhhh.....eehhhhhhhhhh.........................eeeeeeee........eeeeeeee.....eeee.............ee..........eeeeeee.......eee........eee.ee..ee..........eeee..........ee...eee.....eeee..........eeeeeeeeeeeeee..eeeeeeeeee....hhhhh....hhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhhh..hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cuu B  32 ANSYIGTGLDTSLENVKPLPEACKRNVTEFDLVAYGKDEFTLSMEKRVMARMFSAFDVTQLGYLEERKIEHMCKYLGRVMNEDDVKQMKSEINAIDGHITFEKFWAWWCSHPEVPAKKDFFSMVSVDFAVPYHQQQLLTRETGELYTPSYRVLYYFRDMETGKELQVSPWHDIPLYVRDLVRTKPASLPMNRYNFICEIPKWTRAKFEIATGEPFNPIKQDIKNGVPRFYKHGDMMWNYGALPQTWESTDVVFEGGYVGDNDPIDAIEIGMTQFKVGQVGAVKVLGILGMIDDGQMDWKVICISHNDPICRFLKDIHDVPKFLPGCLDAIHEWFRVYKICQGGVENKFVFNGEFKDKSFAMKVIDESHYMWGNLRKINK 410
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CUU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CUU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CUU)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4GA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MLT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5cuu)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cuu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4JH30_TRYCR | Q4JH30
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4JH30_TRYCR | Q4JH30
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4JH30_TRYCR | Q4JH305cuv 5cux

(-) Related Entries Specified in the PDB File

5cuv 5cux 5cuy