5CJ3 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE ZORBAMYCIN BINDING PROTEIN (ZBMA) FROM STREPTOMYCES FLAVOVIRIDIS WITH ZORBAMYCIN

Authors :   C. Chang, L. Bigelow, S. Clancy, G. Babnigg, A. Joachimiak, Midwest Ce Structural Genomics (Mcsg), J. D. Rudolf, M. Ma, C. -Y. Chang, J. R. L D. Yang, B. Shen, Enzyme Discovery For Natural Product Biosynth Enzyme Discovery For Natural Product Biosynthesis (Natpro)

Date :   13 Jul 15 (Deposition) - 22 Jul 15 (Release) - 25 Nov 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.65

Chains :   Asym./Biol. Unit : A,B

Keywords :   Structural Genomics, Psi-Biology, Midwest Center For Structural Genomics, Mcsg, Natpro, Zorbamycin Binding Protein, Enzyme Discovery For Natural Product Biosynthesis, Zorbamycin, Antibiotic Binding Protein-Antibiotic Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. D. Rudolf, L. Bigelow, C. Chang, M. E. Cuff, J. R. Lohman, C. Y. Chang, M. Ma, D. Yang, S. Clancy, G. Babnigg, A. Joachimiak, G. N. Phillips, B. Shen
Crystal Structure Of The Zorbamycin-Binding Protein Zbma, The Primary Self-Resistance Element In Streptomyces Flavoviridis Atcc21892.
Biochemistry V. 54 6842 2015
PubMed-ID: 26512730 | Reference-DOI: 10.1021/ACS.BIOCHEM.5B01008

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR A:35 , GLU A:36 , ASP A:37 , PRO A:59 , ASP A:60 , ASN A:61 , THR A:62 , GLN A:63 , TRP A:65 , ARG A:67 , TYR A:86 , ALA A:89 , THR A:95 , ARG A:98 , TRP A:102 , ARG A:109 , GLY A:113 , LEU A:115 , HIS A:117 , CU A:202 , CL A:203 , HOH A:301 , HOH A:303 , HOH A:309 , HOH A:313 , HOH A:321 , HOH A:325 , HOH A:332 , HOH A:338 , HOH A:357 , HOH A:364 , HOH A:365 , PHE B:33 , THR B:35 , PHE B:38 , GLU B:47 , PHE B:49 , CYS B:51 , SER B:52 , VAL B:53 , 52G B:201 , HOH B:309	binding site for residue 52G A 201
2	AC2	SOFTWARE	52G A:201 , CL A:203	binding site for residue CU A 202
3	AC3	SOFTWARE	GLN A:63 , LEU A:115 , 52G A:201 , CU A:202	binding site for residue CL A 203
4	AC4	SOFTWARE	PHE A:33 , PHE A:38 , GLU A:47 , PHE A:49 , CYS A:51 , SER A:52 , VAL A:53 , 52G A:201 , HOH A:301 , HOH A:321 , ASP B:37 , PRO B:59 , ASP B:60 , ASN B:61 , THR B:62 , GLN B:63 , TRP B:65 , ARG B:67 , TYR B:86 , ALA B:89 , THR B:95 , ARG B:98 , TRP B:102 , ARG B:109 , GLY B:113 , LEU B:115 , HIS B:117 , ALA B:125 , CU B:202 , CL B:203 , HOH B:303 , HOH B:307 , HOH B:318 , HOH B:319 , HOH B:322 , HOH B:325 , HOH B:329 , HOH B:339 , HOH B:346	binding site for residue 52G B 201
5	AC5	SOFTWARE	52G B:201 , CL B:203	binding site for residue CU B 202
6	AC6	SOFTWARE	GLN B:63 , LEU B:115 , 52G B:201 , CU B:202	binding site for residue CL B 203

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:126
                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeeeeeeee.hhhhhhhhhhhh...eeeeee..eeeeee..eeeeeee.....hhhh.eeeeeeehhhhhhhhhh.............ee...eee..eeeeeee.....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cj3 A  -2 SNAMAVLLSGVPVLAALDVSTTQKFWIEVLGFTEEFLTEDFGGVSRDGVELFICSVEDQVVPDNTQAWLRVRDIDALHAEWSARVSSDYADASHPAMTAIREVPWGREFGLRDPAGNLVHFSELSE 123
                                     7        17        27        37        47        57        67        77        87        97       107       117

Chain B from PDB  Type:PROTEIN  Length:126
                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeeeeee.hhhhhhhhhhhh...eeeeee..eeeeee..eeeeeee.....hhhh.eeeeeeehhhhhhhhhhh............ee...eee..eeeeeee.....eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cj3 B   1 MAVLLSGVPVLAALDVSTTQKFWIEVLGFTEEFLTEDFGGVSRDGVELFICSVEDQVVPDNTQAWLRVRDIDALHAEWSARVSSDYADASHPAMTAIREVPWGREFGLRDPAGNLVHFSELSEAAE 126
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (2, 2)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		52G	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5cj3)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5cj3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	B9UIZ4_9ACTN \| B9UIZ4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description