Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PLEXIN INHIBITOR COMPLEX
 
Authors :  Y. Matsunaga, Y. Kitago, T. Arimori, J. Takagi
Date :  19 Apr 16  (Deposition) - 28 Dec 16  (Release) - 28 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,G  (1x)
Biol. Unit 2:  B,H  (1x)
Biol. Unit 3:  C,I  (1x)
Biol. Unit 4:  D,J  (1x)
Biol. Unit 5:  E,K  (1x)
Biol. Unit 6:  F,L  (1x)
Keywords :  Plexin, Inhibitor, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Matsunaga, N. K. Bashiruddin, Y. Kitago, J. Takagi, H. Suga
Allosteric Inhibition Of A Semaphorin 4D Receptor Plexin B1 By A High-Affinity Macrocyclic Peptide
Cell Chem Biol V. 23 1341 2016
PubMed-ID: 27984026  |  Reference-DOI: 10.1016/J.CHEMBIOL.2016.09.015

(-) Compounds

Molecule 1 - PLEXIN-B1
    Chains: A, B, C, D, E, F
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK293S GNT1-
    Expression System Plasmid: PCDNA3.1
    Expression System Taxid: 9606
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 20-535
    Gene: PLXNB1, KIAA0407, PLXN5, SEP
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: SEMAPHORIN RECEPTOR SEP
 
Molecule 2 - SYNTHESIZED CYCLIC PEPTIDE
    Chains: G, H, I, J, K, L
    Engineered: YES
    Organism Scientific: UNIDENTIFIED
    Organism Taxid: 32644
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit : ABCDEFGHIJKL
Biological Unit 1 (1x): A     G     
Biological Unit 2 (1x):  B     H    
Biological Unit 3 (1x):   C     I   
Biological Unit 4 (1x):    D     J  
Biological Unit 5 (1x):     E     K 
Biological Unit 6 (1x):      F     L

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 25)

Asymmetric Unit (4, 25)
No.NameCountTypeFull Name
1ACE6Mod. Amino AcidACETYL GROUP
2DTR6Mod. Amino AcidD-TRYPTOPHAN
3NAG7Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH26Mod. Amino AcidAMINO GROUP
Biological Unit 1 (4, 4)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP
Biological Unit 2 (4, 5)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP
Biological Unit 3 (4, 4)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP
Biological Unit 4 (4, 4)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP
Biological Unit 5 (4, 4)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP
Biological Unit 6 (4, 4)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2DTR1Mod. Amino AcidD-TRYPTOPHAN
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (31, 31)

Asymmetric Unit (31, 31)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:327 , ASN A:334 , ARG A:337 , GLU B:348binding site for Mono-Saccharide NAG A 601 bound to ASN A 334
02AC2SOFTWAREPHE B:28 , THR B:29 , PRO B:30 , ASN B:31 , LEU C:131binding site for Mono-Saccharide NAG B 601 bound to ASN B 31
03AC3SOFTWAREGLU A:348 , ASP B:327 , ARG B:331 , ASN B:334 , ARG B:337binding site for Mono-Saccharide NAG B 602 bound to ASN B 334
04AC4SOFTWAREASP C:327 , ARG C:331 , ASN C:334 , ARG C:337 , GLU D:348binding site for Mono-Saccharide NAG C 601 bound to ASN C 334
05AC5SOFTWAREGLU C:348 , ASP D:330 , ASN D:334 , ARG D:337binding site for Mono-Saccharide NAG D 601 bound to ASN D 334
06AC6SOFTWAREASP E:330 , ASN E:334 , ARG E:337 , GLU F:348binding site for Mono-Saccharide NAG E 601 bound to ASN E 334
07AC7SOFTWAREGLU E:348 , ASP F:327 , ASP F:330 , ASN F:334 , ARG F:337binding site for Mono-Saccharide NAG F 601 bound to ASN F 334
08AC8SOFTWAREALA B:239 , GLN B:240 , SER B:241 , SER G:16binding site for Ligand NH2 G 17 bound to SER G 16
09AC9SOFTWARESER A:241 , SER H:16binding site for Ligand NH2 H 17 bound to SER H 16
10AD1SOFTWAREGLN D:240 , SER D:241 , SER I:16binding site for Ligand NH2 I 17 bound to SER I 16
11AD2SOFTWAREALA C:239 , GLN C:240 , SER C:241 , CYS J:15 , SER J:16binding site for Ligand NH2 J 17 bound to SER J 16
12AD3SOFTWAREGLN F:240 , SER F:241 , SER K:16binding site for Ligand NH2 K 17 bound to SER K 16
13AD4SOFTWARESER E:241 , SER L:16binding site for Ligand NH2 L 17 bound to SER L 16
14AD5SOFTWARETHR A:395 , GLU B:269 , GLY B:270 , GLY B:271 , ARG B:272 , ARG G:2 , TYR G:14 , CYS G:15 , SER G:16binding site for Di-peptide ACE G 0 and DTR G 1
15AD6SOFTWAREARG B:245 , DTR G:1 , ILE G:13 , TYR G:14 , SER G:16binding site for Di-peptide ACE G 0 and CYS G 15
16AD7SOFTWARETHR A:395 , PRO A:396 , GLU A:399 , GLU B:269 , GLY B:270 , GLY B:271 , ARG B:272 , ACE G:0 , PRO G:3 , ARG G:4 , TYR G:14binding site for Di-peptide DTR G 1 and ARG G 2
17AD8SOFTWAREGLU A:269 , GLY A:270 , GLY A:271 , ARG A:272 , ARG H:2 , PRO H:3 , CYS H:15 , SER H:16binding site for Di-peptide ACE H 0 and DTR H 1
18AD9SOFTWAREARG A:245 , GLY A:270 , DTR H:1 , ILE H:13 , TYR H:14 , SER H:16binding site for Di-peptide ACE H 0 and CYS H 15
19AE1SOFTWAREGLU A:269 , GLY A:270 , GLY A:271 , ARG A:272 , PRO B:396 , ILE B:397 , GLU B:399 , ACE H:0 , PRO H:3 , ARG H:4binding site for Di-peptide DTR H 1 and ARG H 2
20AE2SOFTWAREARG D:245 , DTR I:1 , ILE I:13 , TYR I:14 , SER I:16binding site for Di-peptide ACE I 0 and CYS I 15
21AE3SOFTWAREGLU D:269 , GLY D:270 , ARG D:272 , ARG I:2 , PRO I:3 , TYR I:14 , CYS I:15 , SER I:16binding site for Di-peptide ACE I 0 and DTR I 1
22AE4SOFTWAREPRO C:396 , ILE C:397 , GLU C:399 , GLU D:269 , GLY D:270 , ARG D:272 , ACE I:0 , PRO I:3 , ARG I:4 , TYR I:14binding site for Di-peptide DTR I 1 and ARG I 2
23AE5SOFTWAREARG C:245 , DTR J:1 , ILE J:13 , TYR J:14 , SER J:16 , NH2 J:17binding site for Di-peptide ACE J 0 and CYS J 15
24AE6SOFTWAREGLU C:269 , GLY C:270 , GLY C:271 , ARG C:272 , ARG J:2 , PRO J:3 , CYS J:15 , SER J:16binding site for Di-peptide ACE J 0 and DTR J 1
25AE7SOFTWAREGLU C:269 , GLY C:270 , GLY C:271 , ARG C:272 , PRO D:396 , ILE D:397 , GLU D:399 , ACE J:0 , PRO J:3 , ARG J:4binding site for Di-peptide DTR J 1 and ARG J 2
26AE8SOFTWAREARG F:245 , DTR K:1 , ILE K:13 , TYR K:14 , SER K:16binding site for Di-peptide ACE K 0 and CYS K 15
27AE9SOFTWAREGLU F:269 , GLY F:270 , ARG F:272 , ARG K:2 , PRO K:3 , CYS K:15 , SER K:16binding site for Di-peptide ACE K 0 and DTR K 1
28AF1SOFTWAREPRO E:396 , ILE E:397 , GLU E:399 , GLU F:269 , GLY F:270 , ARG F:272 , ACE K:0 , PRO K:3binding site for Di-peptide DTR K 1 and ARG K 2
29AF2SOFTWAREARG E:245 , DTR L:1 , ILE L:13 , TYR L:14 , SER L:16binding site for Di-peptide ACE L 0 and CYS L 15
30AF3SOFTWAREGLU E:269 , GLY E:270 , ARG E:272 , THR F:395 , ARG L:2 , CYS L:15 , SER L:16binding site for Di-peptide ACE L 0 and DTR L 1
31AF4SOFTWAREGLU E:269 , GLY E:270 , ARG E:272 , THR F:395 , PRO F:396 , GLU F:399 , ACE L:0 , PRO L:3 , ARG L:4binding site for Di-peptide DTR L 1 and ARG L 2

(-) SS Bonds  (33, 33)

Asymmetric Unit
No.Residues
1A:79 -A:88
2A:111 -A:119
3A:252 -A:377
4A:268 -A:322
5A:340 -A:364
6B:79 -B:88
7B:111 -B:119
8B:252 -B:377
9B:268 -B:322
10B:340 -B:364
11C:79 -C:88
12C:111 -C:119
13C:252 -C:377
14C:268 -C:322
15C:340 -C:364
16D:79 -D:88
17D:111 -D:119
18D:252 -D:377
19D:268 -D:322
20D:340 -D:364
21E:79 -E:88
22E:111 -E:119
23E:252 -E:377
24E:268 -E:322
25E:340 -E:364
26E:482 -E:499
27E:491 -E:508
28E:502 -E:514
29F:79 -F:88
30F:111 -F:119
31F:252 -F:377
32F:268 -F:322
33F:340 -F:364

(-) Cis Peptide Bonds  (19, 19)

Asymmetric Unit
No.Residues
1Gly A:71 -Pro A:72
2Pro A:81 -Pro A:82
3Ser A:384 -Pro A:385
4Gly B:71 -Pro B:72
5Pro B:81 -Pro B:82
6Ser B:384 -Pro B:385
7Gly C:71 -Pro C:72
8Pro C:81 -Pro C:82
9Ser C:384 -Pro C:385
10Gly D:71 -Pro D:72
11Pro D:81 -Pro D:82
12Glu D:163 -Pro D:164
13Ser D:384 -Pro D:385
14Gly E:71 -Pro E:72
15Pro E:81 -Pro E:82
16Ser E:384 -Pro E:385
17Gly F:71 -Pro F:72
18Pro F:81 -Pro F:82
19Ser F:384 -Pro F:385

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5B4W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5B4W)

(-) Exons   (0, 0)

(no "Exon" information available for 5B4W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:434
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee....eeeee.hhhh.eeee.......eee...................eeeeeee.....eeeeeee.......eeeee....hhhhh..eeeeee....hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee......eeeeeee..........eeeeeee....eeeeeeehhhhhhhhhhhhhhhhhh..........eee............hhhhhhh..........eee...eee...eee....eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b4w A  26 TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS 481
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       181       191       201       211       221       231       241       251       261       271       281       291       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477    
                                                                                                                                                                              174|                                                                                                                    300|                                                                                                                                                                    
                                                                                                                                                                               181                                                                                                                     317                                                                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:434
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee....eeeee.hhhh.eeeee..eeeeeee...................eeeeeee.....eeeeeee.......eeeee....hhhhh............hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee.hhh..eeeeeee..........eeeeeee...eeeeeeeehhhhhhhhhhhhhhhhhh..........eee.............hhhhhh..........eee...eee...eeee...eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b4w B  26 TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS 481
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       181       191       201       211       221       231       241       251       261       271       281       291       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477    
                                                                                                                                                                              174|                                                                                                                    300|                                                                                                                                                                    
                                                                                                                                                                               181                                                                                                                     317                                                                                                                                                                    


Chain C from PDB  Type:PROTEIN  Length:442
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee...eeeeee.hhhh.eeeee......eee...................eeeeee.....eeeeee.........eeeee....hhhhh..eeeeee....hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee.hhh..eeeeeee..........eeeeeeeee......eee.eeeeeeehhhhhhhhhhhhhhhhhh..........eee.............hhhhhh..........eee...eee...eee....eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b4w C  26 TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQAGEPLLFVGRGYTSRGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPRPPSAAAASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS 481
                                    35        45        55        65        75        85        95       105       115       125       135       145       155  ||   167       181       191       201       211       221       231       241       251       261       271       281       291       301||     319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479  
                                                                                                                                                              158|           175|                                                                                                                       302|   313|                                                                                                                                                                   
                                                                                                                                                               161            180                                                                                                                        307    318                                                                                                                                                                   


Chain D from PDB  Type:PROTEIN  Length:436
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee....eeeee.hhhh.eeee.......eee.....hhhhh.........eeeeee.......eeeeee.......eeeee....hhhhh............hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee......eeeeeee........eeeeeee......eeeeeeehhhhhhhhhhhhhhhhhh..........eee...........hhhhhhhh..........eee...eee...eee....eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b4w D  24 PPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSVAHGEVLFAAFSSAAPGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS 481
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173||     189       199       209       219       229       239       249       259       269       279    || 291       301||     325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475      
                                                                                                                                                                                174|                                                                                                    284|            302|                                                                                                                                                                    
                                                                                                                                                                                 181                                                                                                     287             317                                                                                                                                                                    


Chain E from PDB  Type:PROTEIN  Length:478
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee....eeeeehhhhhheeeee..eeeeeee...................eeeeeee.....eeeeeee..........eeeee....hhhhh............hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee......eeeeeee..........eeeeeee....eeeeeeehhhhhhhhhhhhhhhhhh..........eee.............hhhhhh..........eee...eee...eee....eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee..hhhhh.hhhhhhhh....eeee....eeee.hhh..eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b4w E  26 TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSQWLWSFQ 528
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175||     188       198       208       218       228       238       248       258       268       278       288       298 ||    324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514||      
                                                                                                                                                                                176|                                                                                                                     300|                                                                                                                                                                                                   515|      
                                                                                                                                                                                 180                                                                                                                      317                                                                                                                                                                                                    522      


Chain F from PDB  Type:PROTEIN  Length:438
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee......eeeeee......eeeee..eeeee.....eeeeee...eee................eee...eeeeee...eeeeee.hhhh.eeeee......eee...................eeeeeee.....eeeeeee..........eeeee....hhhhh............hhhhhh.eeeeeeee..eeeeeeeee........eeeeeeeee.........eeeeeee.hhh..eeeeeee..........eeeeeee....eeeeeeeehhhhhhhhhhhhhhhhhh..........eee.............hhhhhh..........eee...eee...eeee...eeeeeeeee..eeeeeeee...eeeeee..........eeee...........ee.....eeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b4w F  26 TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS 481
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175||     188       198       208       218       228       238       248       258       268       278       288       298 ||    323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473        
                                                                                                                                                                                176|                                                                                                                     300|                                                                                                                                                                     
                                                                                                                                                                                 180                                                                                                                      316                                                                                                                                                                     


Chain G from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w G   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            0-ACE           17-NH2
                             1-DTR            


Chain H from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w H   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            ||              17-NH2
                            0-ACE             
                             1-DTR            


Chain I from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w I   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            ||              17-NH2
                            0-ACE             
                             1-DTR            


Chain J from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w J   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            ||              17-NH2
                            0-ACE             
                             1-DTR            


Chain K from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w K   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            ||              17-NH2
                            0-ACE             
                             1-DTR            


Chain L from PDB  Type:PROTEIN  Length:18
                                                  
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ....ee......ee.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
                 Transcript ------------------ Transcript
                 5b4w L   0 xxRPRVARWTGQIIYCSx  17
                            ||       9       |
                            ||              17-NH2
                            0-ACE             
                             1-DTR
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5B4W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5B4W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5B4W)

(-) Gene Ontology  (32, 32)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DTR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu D:163 - Pro D:164   [ RasMol ]  
    Gly A:71 - Pro A:72   [ RasMol ]  
    Gly B:71 - Pro B:72   [ RasMol ]  
    Gly C:71 - Pro C:72   [ RasMol ]  
    Gly D:71 - Pro D:72   [ RasMol ]  
    Gly E:71 - Pro E:72   [ RasMol ]  
    Gly F:71 - Pro F:72   [ RasMol ]  
    Pro A:81 - Pro A:82   [ RasMol ]  
    Pro B:81 - Pro B:82   [ RasMol ]  
    Pro C:81 - Pro C:82   [ RasMol ]  
    Pro D:81 - Pro D:82   [ RasMol ]  
    Pro E:81 - Pro E:82   [ RasMol ]  
    Pro F:81 - Pro F:82   [ RasMol ]  
    Ser A:384 - Pro A:385   [ RasMol ]  
    Ser B:384 - Pro B:385   [ RasMol ]  
    Ser C:384 - Pro C:385   [ RasMol ]  
    Ser D:384 - Pro D:385   [ RasMol ]  
    Ser E:384 - Pro E:385   [ RasMol ]  
    Ser F:384 - Pro F:385   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5b4w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLXB1_HUMAN | O43157
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PLXB1_HUMAN | O43157
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLXB1_HUMAN | O43157: 2jph 2os6 2r2o 2rex 3hm6 3ol2 3su8 3sua

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5B4W)