2OS6 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF LARG PDZ DOMAIN IN COMPLEX WITH C-TERMINAL OCTA-PEPTIDE OF PLEXIN B1

Authors :   J. Liu, H. Huang, Y. Yang

Date :   05 Feb 07 (Deposition) - 12 Feb 08 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Nerve System Development, Cytoskeleton Rearrangement, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Liu, H. Huang, Y. Yang
Solution Structure Of The Larg Pdz Domain In Complex With C-Terminal Peptide Of Plexin B1
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 12
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET15B (+)
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	PDZ DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	LARG PROTEIN, LEUKEMIA-ASSOCIATED RHOGEF

Molecule 2 - C-TERMINAL PEPTIDE OF PLEXIN-B1
	Chains	:	B
	Engineered	:	YES
	Other Details	:	THIS SEQUENCE OCCURS NATURALLY IN HUMANS
	Synonym	:	SEMAPHORIN RECEPTOR SEP
	Synthetic	:	YES


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2OS6)

(no "Site" information available for 2OS6)

(no "SS Bond" information available for 2OS6)

(no "Cis Peptide Bond" information available for 2OS6)

(no "SAP(SNP)/Variant" information available for 2OS6)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDZ	PS50106	PDZ domain profile.	ARHGC_HUMAN	72-136	1	A:10-74

NMR Structure (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3b	ENST00000358536	3b	ENSE00001668057	chr3:48470872-48470662	211	PLXB1_HUMAN	-	0	0	-	-
1.4a	ENST00000358536	4a	ENSE00001428482	chr3:48466742-48466690	53	PLXB1_HUMAN	-	0	0	-	-
1.5a	ENST00000358536	5a	ENSE00001206107	chr3:48466026-48464914	1113	PLXB1_HUMAN	1-369	369	0	-	-
1.6	ENST00000358536	6	ENSE00001080883	chr3:48464356-48464174	183	PLXB1_HUMAN	370-430	61	0	-	-
1.7a	ENST00000358536	7a	ENSE00001080893	chr3:48463868-48463740	129	PLXB1_HUMAN	431-473	43	0	-	-
1.8	ENST00000358536	8	ENSE00001080898	chr3:48463614-48463514	101	PLXB1_HUMAN	474-507	34	0	-	-
1.9	ENST00000358536	9	ENSE00001080910	chr3:48463215-48463083	133	PLXB1_HUMAN	507-551	45	0	-	-
1.10	ENST00000358536	10	ENSE00001080902	chr3:48462793-48462637	157	PLXB1_HUMAN	552-604	53	0	-	-
1.11	ENST00000358536	11	ENSE00001080906	chr3:48462365-48462257	109	PLXB1_HUMAN	604-640	37	0	-	-
1.12	ENST00000358536	12	ENSE00001080876	chr3:48462182-48462074	109	PLXB1_HUMAN	640-676	37	0	-	-
1.13c	ENST00000358536	13c	ENSE00001326499	chr3:48461666-48460986	681	PLXB1_HUMAN	677-903	227	0	-	-
1.13g	ENST00000358536	13g	ENSE00001673675	chr3:48460775-48460653	123	PLXB1_HUMAN	904-944	41	0	-	-
1.14	ENST00000358536	14	ENSE00001644091	chr3:48460448-48460326	123	PLXB1_HUMAN	945-985	41	0	-	-
1.15	ENST00000358536	15	ENSE00001632794	chr3:48459951-48459858	94	PLXB1_HUMAN	986-1017	32	0	-	-
1.16b	ENST00000358536	16b	ENSE00001689569	chr3:48459772-48459600	173	PLXB1_HUMAN	1017-1074	58	0	-	-
1.17	ENST00000358536	17	ENSE00001688877	chr3:48459471-48459320	152	PLXB1_HUMAN	1075-1125	51	0	-	-
1.18b	ENST00000358536	18b	ENSE00001630248	chr3:48457860-48457755	106	PLXB1_HUMAN	1125-1160	36	0	-	-
1.19	ENST00000358536	19	ENSE00001685598	chr3:48457576-48457440	137	PLXB1_HUMAN	1161-1206	46	0	-	-
1.20a	ENST00000358536	20a	ENSE00001604226	chr3:48457168-48456992	177	PLXB1_HUMAN	1206-1265	60	0	-	-
1.21c	ENST00000358536	21c	ENSE00001725709	chr3:48456756-48456585	172	PLXB1_HUMAN	1265-1322	58	0	-	-
1.22b	ENST00000358536	22b	ENSE00001726311	chr3:48456450-48456208	243	PLXB1_HUMAN	1323-1403	81	0	-	-
1.23c	ENST00000358536	23c	ENSE00001731310	chr3:48455480-48455304	177	PLXB1_HUMAN	1404-1462	59	0	-	-
1.23h	ENST00000358536	23h	ENSE00001788421	chr3:48455227-48455079	149	PLXB1_HUMAN	1463-1512	50	0	-	-
1.23j	ENST00000358536	23j	ENSE00001633158	chr3:48454578-48454478	101	PLXB1_HUMAN	1512-1546	35	0	-	-
1.24a	ENST00000358536	24a	ENSE00001749742	chr3:48454368-48454151	218	PLXB1_HUMAN	1546-1618	73	0	-	-
1.25	ENST00000358536	25	ENSE00001745479	chr3:48454029-48453851	179	PLXB1_HUMAN	1619-1678	60	0	-	-
1.26a	ENST00000358536	26a	ENSE00001731741	chr3:48453713-48453647	67	PLXB1_HUMAN	1678-1700	23	0	-	-
1.26c	ENST00000358536	26c	ENSE00001740702	chr3:48453418-48453272	147	PLXB1_HUMAN	1701-1749	49	0	-	-
1.27b	ENST00000358536	27b	ENSE00001769186	chr3:48452445-48452277	169	PLXB1_HUMAN	1750-1806	57	0	-	-
1.27d	ENST00000358536	27d	ENSE00001752233	chr3:48451967-48451864	104	PLXB1_HUMAN	1806-1840	35	0	-	-
1.28a	ENST00000358536	28a	ENSE00001597624	chr3:48451789-48451705	85	PLXB1_HUMAN	1841-1869	29	0	-	-
1.29b	ENST00000358536	29b	ENSE00001747202	chr3:48451486-48451314	173	PLXB1_HUMAN	1869-1926	58	0	-	-
1.30a	ENST00000358536	30a	ENSE00001685743	chr3:48451139-48450979	161	PLXB1_HUMAN	1927-1980	54	0	-	-
1.30d	ENST00000358536	30d	ENSE00001746046	chr3:48450884-48450737	148	PLXB1_HUMAN	1980-2029	50	0	-	-
1.31a	ENST00000358536	31a	ENSE00001798246	chr3:48448498-48448434	65	PLXB1_HUMAN	2030-2051	22	0	-	-
1.32a	ENST00000358536	32a	ENSE00001737780	chr3:48448305-48448230	76	PLXB1_HUMAN	2051-2076	26	0	-	-
1.33b	ENST00000358536	33b	ENSE00001624889	chr3:48447205-48447131	75	PLXB1_HUMAN	2077-2101	25	0	-	-
1.34c	ENST00000358536	34c	ENSE00001862726	chr3:48445997-48445263	735	PLXB1_HUMAN	2102-2135	34	1	B:90-97	8

2.1a	ENST00000397843	1a	ENSE00002172160	chr11:120207787-120207984	198	ARHGC_HUMAN	1-11	11	0	-	-
2.3b	ENST00000397843	3b	ENSE00001364534	chr11:120276827-120276850	24	ARHGC_HUMAN	11-19	9	0	-	-
2.4a	ENST00000397843	4a	ENSE00000990332	chr11:120278447-120278532	86	ARHGC_HUMAN	19-48	30	1	A:1-3	3
2.4c	ENST00000397843	4c	ENSE00001530577	chr11:120280103-120280159	57	ARHGC_HUMAN	48-67	20	1	A:4-5	2
2.5	ENST00000397843	5	ENSE00000990335	chr11:120291462-120291560	99	ARHGC_HUMAN	67-100	34	1	A:5-38	34
2.6	ENST00000397843	6	ENSE00001125958	chr11:120292512-120292561	50	ARHGC_HUMAN	100-116	17	1	A:38-54	17
2.7	ENST00000397843	7	ENSE00000990338	chr11:120295067-120295124	58	ARHGC_HUMAN	117-136	20	1	A:55-74	20
2.8	ENST00000397843	8	ENSE00000990339	chr11:120298778-120298956	179	ARHGC_HUMAN	136-195	60	1	A:74-89	16
2.9	ENST00000397843	9	ENSE00000990340	chr11:120300149-120300226	78	ARHGC_HUMAN	196-221	26	0	-	-
2.10	ENST00000397843	10	ENSE00000990342	chr11:120300421-120300540	120	ARHGC_HUMAN	222-261	40	0	-	-
2.11	ENST00000397843	11	ENSE00000990343	chr11:120302480-120302620	141	ARHGC_HUMAN	262-308	47	0	-	-
2.12	ENST00000397843	12	ENSE00001205806	chr11:120308017-120308091	75	ARHGC_HUMAN	309-333	25	0	-	-
2.13b	ENST00000397843	13b	ENSE00001205799	chr11:120310838-120310930	93	ARHGC_HUMAN	334-364	31	0	-	-
2.14	ENST00000397843	14	ENSE00001205793	chr11:120312416-120312526	111	ARHGC_HUMAN	365-401	37	0	-	-
2.15	ENST00000397843	15	ENSE00001205786	chr11:120312813-120312911	99	ARHGC_HUMAN	402-434	33	0	-	-
2.16	ENST00000397843	16	ENSE00001205988	chr11:120316131-120316173	43	ARHGC_HUMAN	435-449	15	0	-	-
2.17	ENST00000397843	17	ENSE00001205778	chr11:120317112-120317217	106	ARHGC_HUMAN	449-484	36	0	-	-
2.18a	ENST00000397843	18a	ENSE00001125859	chr11:120317657-120317794	138	ARHGC_HUMAN	484-530	47	0	-	-
2.19	ENST00000397843	19	ENSE00000990353	chr11:120318583-120318615	33	ARHGC_HUMAN	530-541	12	0	-	-
2.20	ENST00000397843	20	ENSE00000990354	chr11:120318943-120319057	115	ARHGC_HUMAN	541-579	39	0	-	-
2.21b	ENST00000397843	21b	ENSE00001205763	chr11:120319818-120319923	106	ARHGC_HUMAN	580-615	36	0	-	-
2.22c	ENST00000397843	22c	ENSE00001125819	chr11:120322221-120322433	213	ARHGC_HUMAN	615-686	72	0	-	-
2.23	ENST00000397843	23	ENSE00000990358	chr11:120327827-120327959	133	ARHGC_HUMAN	686-730	45	0	-	-
2.24c	ENST00000397843	24c	ENSE00000990359	chr11:120328430-120328465	36	ARHGC_HUMAN	730-742	13	0	-	-
2.24d	ENST00000397843	24d	ENSE00000990360	chr11:120328789-120328943	155	ARHGC_HUMAN	742-794	53	0	-	-
2.24f	ENST00000397843	24f	ENSE00001125791	chr11:120329883-120330029	147	ARHGC_HUMAN	794-843	50	0	-	-
2.25	ENST00000397843	25	ENSE00000990363	chr11:120331381-120331466	86	ARHGC_HUMAN	843-871	29	0	-	-
2.26b	ENST00000397843	26b	ENSE00000990365	chr11:120335946-120336071	126	ARHGC_HUMAN	872-913	42	0	-	-
2.27	ENST00000397843	27	ENSE00000990366	chr11:120337903-120338017	115	ARHGC_HUMAN	914-952	39	0	-	-
2.28	ENST00000397843	28	ENSE00000990367	chr11:120339997-120340097	101	ARHGC_HUMAN	952-985	34	0	-	-
2.29	ENST00000397843	29	ENSE00000990368	chr11:120343759-120343836	78	ARHGC_HUMAN	986-1011	26	0	-	-
2.30	ENST00000397843	30	ENSE00001125877	chr11:120345269-120345344	76	ARHGC_HUMAN	1012-1037	26	0	-	-
2.31	ENST00000397843	31	ENSE00001430984	chr11:120346049-120346216	168	ARHGC_HUMAN	1037-1093	57	0	-	-
2.32b	ENST00000397843	32b	ENSE00001402131	chr11:120347370-120347457	88	ARHGC_HUMAN	1093-1122	30	0	-	-
2.33b	ENST00000397843	33b	ENSE00001125767	chr11:120347928-120348014	87	ARHGC_HUMAN	1122-1151	30	0	-	-
2.34a	ENST00000397843	34a	ENSE00000990377	chr11:120348156-120348235	80	ARHGC_HUMAN	1151-1178	28	0	-	-
2.35	ENST00000397843	35	ENSE00000990378	chr11:120348865-120349098	234	ARHGC_HUMAN	1178-1256	79	0	-	-
2.36b	ENST00000397843	36b	ENSE00001125757	chr11:120350669-120351139	471	ARHGC_HUMAN	1256-1413	158	0	-	-
2.37	ENST00000397843	37	ENSE00001401289	chr11:120351969-120352285	317	ARHGC_HUMAN	1413-1518	106	0	-	-
2.38	ENST00000397843	38	ENSE00001369958	chr11:120355147-120355216	70	ARHGC_HUMAN	1519-1542	24	0	-	-
2.39b	ENST00000397843	39b	ENSE00001364735	chr11:120355776-120360645	4870	ARHGC_HUMAN	1542-1544	3	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:89
 aligned with ARHGC_HUMAN | Q9NZN5 from UniProtKB/Swiss-Prot  Length:1544

    Alignment length:112
                                    49        59        69        79        89        99       109       119       129       139       149  
         ARHGC_HUMAN     40 ASHDFDPTDSSSKKTKSSSEESRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQGRPPGS  151
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2os                       6A00 A:1-89  [code=2.30.42.10, no name defined]                                        CATH domains
               Pfam domains ---------------------------------PDZ-2os6A01 A:11-83                                                      ------ Pfam domains
         Sec.struct. author ...-----------------------...eeeeeee........eeee.....eeeee...hhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------PDZ  PDB: A:10-74 UniProt: 72-136                                --------------- PROSITE
           Transcript 2 (1) Exon 2.4a------------------Exon 2.5  PDB: A:5-38             ----------------Exon 2.7            --------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.4c  PDB: A:4---------------------------------Exon 2.6         -------------------Exon 2.8         Transcript 2 (2)
                2os6 A    1 GSH-----------------------MGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQGRPPGS   89
                              |      -         -      |  7        17        27        37        47        57        67        77        87  
                              3                       4

Chain B from PDB  Type:PROTEIN  Length:8
 aligned with PLXB1_HUMAN | O43157 from UniProtKB/Swiss-Prot  Length:2135

    Alignment length:8
         PLXB1_HUMAN   2128 VENKVTDL 2135
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ....eee. Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
               Transcript 1 1.34c    Transcript 1
                2os6 B   90 VENKVTDL   97

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2OS6)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: Pdz3 Domain (191)

Homologous Superfamily: [code=2.30.42.10, no name defined] (191)

Human (Homo sapiens) (120)

2os6A00

A:1-89

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PDZ-like (184)

Family: PDZ (172)

Homo sapiens (Human) (96)

PDZ-2os6A01

A:11-83

NMR Structure(hide GO term definitions)

Chain A (ARHGC_HUMAN | Q9NZN5)

molecular function
	GO:0001664	G-protein coupled receptor binding	Interacting selectively and non-covalently with a G-protein coupled receptor.
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005089	Rho guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005085	guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain B (PLXB1_HUMAN | O43157)

molecular function
	GO:0032794	GTPase activating protein binding	Interacting selectively and non-covalently with a GTPase activating protein.
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0017154	semaphorin receptor activity	Combining with a semaphorin, and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0030215	semaphorin receptor binding	Interacting selectively and non-covalently with semaphorin receptors.
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
	GO:0048675	axon extension	Long distance growth of a single axon process involved in cellular development.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0007162	negative regulation of cell adhesion	Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
	GO:0033689	negative regulation of osteoblast proliferation	Any process that stops, prevents or reduces the rate or extent of osteoblast proliferation.
	GO:0048812	neuron projection morphogenesis	The process in which the anatomical structures of a neuron projection are generated and organized. A neuron projection is any process extending from a neural cell, such as axons or dendrites.
	GO:0043931	ossification involved in bone maturation	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone, involved in the progression of the skeleton from its formation to its mature state.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0050772	positive regulation of axonogenesis	Any process that activates or increases the frequency, rate or extent of axonogenesis.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0043087	regulation of GTPase activity	Any process that modulates the rate of GTP hydrolysis by a GTPase.
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0051493	regulation of cytoskeleton organization	Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0071526	semaphorin-plexin signaling pathway	A series of molecular signals generated as a consequence of a semaphorin receptor (composed of a plexin and a neurophilin) binding to a semaphorin ligand.
	GO:1902287	semaphorin-plexin signaling pathway involved in axon guidance	Any semaphorin-plexin signaling pathway that is involved in axon guidance.
	GO:1900220	semaphorin-plexin signaling pathway involved in bone trabecula morphogenesis	Any semaphorin-plexin signaling pathway that contributes to bone trabecula morphogenesis.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0002116	semaphorin receptor complex	A stable binary complex of a neurophilin and a plexin, together forming a functional semaphorin receptor.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2os6)

	Sites
(no "Sites" information available for 2os6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2os6)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2os6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARHGC_HUMAN \| Q9NZN5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PLXB1_HUMAN \| O43157
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARHGC_HUMAN \| Q9NZN5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PLXB1_HUMAN \| O43157
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ARHGC_HUMAN \| Q9NZN5	:	1txd 1x86 2omj
	PLXB1_HUMAN \| O43157	:	2jph 2r2o 2rex 3hm6 3ol2 3su8 3sua 5b4w

2omj	THE SAME PROTEIN COMPLEXED WITH C-TERMINAL PEPTIDE OF PLEXIN B1

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (42, 47)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File