Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  LIGANDIN BINDING SITE OF PFGST
 
Authors :  M. Perbandt, R. Eberle, C. Betzel
Date :  20 May 15  (Deposition) - 24 Jun 15  (Release) - 09 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Gst, Plasmodium Falciparum, Hemin, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Perbandt, R. Eberle, L. Fischer-Riepe, H. Cang, E. Liebau, C. Betze
High Resolution Structures Of Plasmodium Falciparum Gst Complexes Provide Novel Insights Into The Dimer-Tetramer Transition And A Novel Ligand-Binding Site.
J. Struct. Biol. V. 191 365 2015
PubMed-ID: 26072058  |  Reference-DOI: 10.1016/J.JSB.2015.06.008

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
    ChainsA, B
    EC Number2.5.1.18
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 3-207
    GeneGST
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid5833
    SynonymPFGST

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric Unit (3, 8)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3SO44Ligand/IonSULFATE ION
Biological Unit 1 (3, 16)
No.NameCountTypeFull Name
1GOL4Ligand/IonGLYCEROL
2MES4Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3SO48Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:8 , LYS A:52binding site for residue SO4 A 301
02AC2SOFTWAREMES A:305binding site for residue SO4 A 302
03AC3SOFTWARETYR A:83 , HOH A:406 , ASN B:84binding site for residue SO4 A 303
04AC4SOFTWAREASN A:84 , GLU A:88 , LYS B:82 , TYR B:83binding site for residue GOL A 304
05AC5SOFTWARETYR A:25 , LEU A:26 , LEU A:196 , PRO A:197 , ASN A:198 , SO4 A:302binding site for residue MES A 305
06AC6SOFTWARELYS B:15 , GLN B:71 , SER B:72 , GLN B:73 , HOH B:405 , HOH B:415 , HOH B:432binding site for residue SO4 B 301
07AC7SOFTWARETYR B:108 , HOH B:408 , HOH B:434binding site for residue GOL B 302
08AC8SOFTWARETYR B:25 , LEU B:26 , LEU B:196 , PRO B:197 , ASN B:198binding site for residue MES B 303
09AC9SOFTWAREASN A:201 , LEU B:180 , ASN B:182 , PHE B:183binding site for Ligand LYS B 181 bound to ASN A 148
10AD1SOFTWAREASN A:201 , LEU B:180 , ASN B:182 , PHE B:183binding site for Ligand LYS B 181 bound to ASN A 148
11AD2SOFTWAREASN A:201 , LEU B:180 , ASN B:182 , PHE B:183binding site for Ligand LYS B 181 bound to ASN A 148

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZXG)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Val A:59 -Pro A:60
2Val B:59 -Pro B:60

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZXG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZXG)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZXG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:202
                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxg A   3 DNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNKYYFVGNNLTYADLAVFNLYDDIETKYPSLKNFPLLKAHNEFISNLPNIKNYITNRK 207
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142    || 154       164       174  ||   185       195       205  
                                                                                                                                                                          147|                        177|                            
                                                                                                                                                                           150                         179                            

Chain B from PDB  Type:PROTEIN  Length:194
                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhhh...eeeee...hhhhhhhhhhhh........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zxg B   3 DNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNDKYYFVGNNLTYADLAVFNLYDDIETKYLKNFPLLKAHNEFISNLPNIKNYITNRK 207
                                    12        22        32    ||  44        54        64        74        84        94       104       114       124       134       150       160       170     ||183       193       203    
                                                             37|                                                                                                   142|                        176|                           
                                                              40                                                                                                    149                         180                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZXG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZXG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZXG)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:59 - Pro A:60   [ RasMol ]  
    Val B:59 - Pro B:60   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zxg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GST_PLAFA | Q8MU52
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GST_PLAFA | Q8MU52
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GST_PLAFA | Q8MU521okt 1pa3 1q4j 2aaw 3fr3 3fr6 3fr9 3frc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZXG)