Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  TETRAMERIZATION AND COOPERATIVITY IN PLASMODIUM FALCIPARUM GLUTATHIONE TRANSFERASE ARE MEDIATED BY THE ATYPIC LOOP 113-118
 
Authors :  M. Perbandt, E. Liebau, G. Ricci
Date :  08 Jan 09  (Deposition) - 26 Jan 10  (Release) - 26 Jan 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Plasmodium Falciparum, Pfgst, Oxidative Stress, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Perbandt, E. Liebau, G. Ricci
Tetramerization And Cooperativity In Plasmodium Falciparum Glutathione Transferase Are Mediated By The Atypic Loop 113-118
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
    ChainsA, B
    EC Number2.5.1.18
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPJC20
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid5833
    SynonymPFGST

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1GDS2Ligand/IonOXIDIZED GLUTATHIONE DISULFIDE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1GDS4Ligand/IonOXIDIZED GLUTATHIONE DISULFIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:9 , PHE A:10 , ALA A:12 , ARG A:13 , GLY A:14 , LYS A:15 , PHE A:45 , GLN A:58 , VAL A:59 , PRO A:60 , GLN A:71 , SER A:72 , ASP A:105 , HOH A:211 , HOH A:228 , HOH A:271 , HOH A:285 , HOH A:304 , HOH A:315 , ALA B:115 , ASN B:116 , GLU B:117 , THR B:118 , LYS B:172 , HOH B:257 , HOH B:266BINDING SITE FOR RESIDUE GDS A 400
2AC2SOFTWAREALA A:115 , GLU A:117 , THR A:118 , HOH A:338 , TYR B:9 , PHE B:10 , ALA B:12 , ARG B:13 , GLY B:14 , GLN B:58 , VAL B:59 , PRO B:60 , GLN B:71 , SER B:72 , ASP B:105 , HOH B:222 , HOH B:237BINDING SITE FOR RESIDUE GDS B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FR3)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Val A:59 -Pro A:60
2Thr A:113 -Ala A:114
3Asn A:144 -Asn A:145
4Asn A:145 -Asp A:146
5Val B:37 -Asn B:38
6Asn B:38 -Gly B:39
7Gly B:39 -Asp B:40
8Asp B:40 -Ala B:41
9Ala B:41 -Phe B:42
10Phe B:42 -Val B:43
11Val B:59 -Pro B:60
12Ala B:114 -Ala B:115

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3FR3)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GST_PLAFA89-211
 
  2A:89-204
B:89-204
Biological Unit 1 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GST_PLAFA89-211
 
  4A:89-204
B:89-204

(-) Exons   (0, 0)

(no "Exon" information available for 3FR3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with GST_PLAFA | Q8MU52 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:204
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203    
            GST_PLAFA     4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 207
               SCOP domains d3fr3a1 A:4-85 automated matches                                                  d3fr3a2 A:86-204 automated m   atches                                                                                      SCOP domains
               CATH domains 3fr3A01 A:4-85 Glutaredoxin                                                       3fr3A02 A:86-204  [code=1.20   .1050.10, no name defined]                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.---..hhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------GST_CTER  PDB: A:89-204 UniProt: 89-211                                                                                 PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3fr3 A   4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNT---AANETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 204
                                    13        23        33        43        53        63        73        83        93       103       113   |   120       130       140       150       160       170       180       190       200    
                                                                                                                                       113 114                                                                                          

Chain B from PDB  Type:PROTEIN  Length:198
 aligned with GST_PLAFA | Q8MU52 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:204
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203    
            GST_PLAFA     4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 207
               SCOP domains d3fr3b1 B:4-85 automated matches                                                  d3fr3b2 B:86-204 automated m   atches                                                                                      SCOP domains
               CATH domains 3fr3B01 B:4-85 Glutaredoxin                                                       3fr3B02 B:86-204  [code=1.20   .1050.10, no name defined]                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeee........hhhhhhhhh........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.---...hhhhhhhhhhhhhhhhhhhhhhh....---.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------GST_CTER  PDB: B:89-204 UniProt: 89-211                                                                                 PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3fr3 B   4 NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNT---AANETTFLNEDLPKWSGYFEKLLKKNHTNN---KYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK 204
                                    13        23        33        43        53        63        73        83        93       103       113   |   120       130       140  |   |150       160       170       180       190       200    
                                                                                                                                       113 114                          143 147                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FR3)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (GST_PLAFA | Q8MU52)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GDS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala B:114 - Ala B:115   [ RasMol ]  
    Ala B:41 - Phe B:42   [ RasMol ]  
    Asn A:144 - Asn A:145   [ RasMol ]  
    Asn A:145 - Asp A:146   [ RasMol ]  
    Asn B:38 - Gly B:39   [ RasMol ]  
    Asp B:40 - Ala B:41   [ RasMol ]  
    Gly B:39 - Asp B:40   [ RasMol ]  
    Phe B:42 - Val B:43   [ RasMol ]  
    Thr A:113 - Ala A:114   [ RasMol ]  
    Val A:59 - Pro A:60   [ RasMol ]  
    Val B:37 - Asn B:38   [ RasMol ]  
    Val B:59 - Pro B:60   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fr3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GST_PLAFA | Q8MU52
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GST_PLAFA | Q8MU52
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GST_PLAFA | Q8MU521okt 1pa3 1q4j 2aaw 3fr6 3fr9 3frc 4zxg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FR3)