Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN CARBONYL REDUCTASE 1 WITH GLUTATHIONE IN A PROTECTIVE CONFIGURATION
 
Authors :  Y. Ding, Q. Liang
Date :  31 Mar 15  (Deposition) - 14 Oct 15  (Release) - 14 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Glutathione, Nadph, Carbonyl Reductase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Liang, R. Liu, S. Du, Y. Ding
Structural Insights On The Catalytic Site Protection Of Human Carbonyl Reductase 1 By Glutathione.
J. Struct. Biol. V. 192 138 2015
PubMed-ID: 26381805  |  Reference-DOI: 10.1016/J.JSB.2015.09.005

(-) Compounds

Molecule 1 - CARBONYL REDUCTASE [NADPH] 1
    Chains: A, B, C, D
    EC Number: 1.1.1.184, 1.1.1.197, 1.1.1.189
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CBR1, CBR, CRN, SDR21C1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: 15-HYDROXYPROSTAGLANDIN DEHYDROGENASE [NADP(+)],NADPH- DEPENDENT CARBONYL REDUCTASE 1,PROSTAGLANDIN 9-KETOREDUCTASE, PROSTAGLANDIN-E(2) 9-REDUCTASE,SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY 21C MEMBER 1

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1GSH4Ligand/IonGLUTATHIONE
2NDP4Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE
2NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE
2NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:94 , LYS A:95 , PHE A:102 , GLN A:105 , SER A:139 , MET A:141 , SER A:191 , ALA A:192 , TYR A:193 , MET A:234 , ALA A:235 , NDP A:302 , HOH A:449 , HOH A:455 , HOH A:517 , HOH A:549 , HOH A:606 , HOH A:628binding site for residue GSH A 301
2AC2SOFTWAREGLY A:11 , ASN A:13 , LYS A:14 , GLY A:15 , ILE A:16 , ARG A:37 , ARG A:41 , LEU A:61 , ASP A:62 , ILE A:63 , ASP A:64 , ASN A:89 , ALA A:90 , GLY A:91 , ILE A:92 , VAL A:137 , SER A:138 , TYR A:193 , LYS A:197 , PRO A:227 , GLY A:228 , TRP A:229 , VAL A:230 , THR A:232 , ASP A:233 , MET A:234 , ALA A:235 , GSH A:301 , HOH A:407 , HOH A:418 , HOH A:437 , HOH A:463 , HOH A:493 , HOH A:509 , HOH A:516 , HOH A:526 , HOH A:528 , HOH A:562binding site for residue NDP A 302
3AC3SOFTWAREPHE B:94 , LYS B:95 , GLN B:105 , SER B:139 , MET B:141 , SER B:191 , ALA B:192 , TYR B:193 , MET B:234 , ALA B:235 , NDP B:302 , HOH B:438 , HOH B:512 , HOH B:519 , HOH B:599 , HOH B:607 , HOH B:618binding site for residue GSH B 301
4AC4SOFTWAREGLY B:11 , ASN B:13 , LYS B:14 , GLY B:15 , ILE B:16 , ARG B:37 , ARG B:41 , LEU B:61 , ASP B:62 , ILE B:63 , ASP B:64 , ASN B:89 , ALA B:90 , GLY B:91 , ILE B:92 , VAL B:137 , SER B:138 , SER B:139 , TYR B:193 , LYS B:197 , PRO B:227 , GLY B:228 , TRP B:229 , VAL B:230 , THR B:232 , ASP B:233 , MET B:234 , ALA B:235 , GSH B:301 , HOH B:401 , HOH B:437 , HOH B:448 , HOH B:451 , HOH B:457 , HOH B:468 , HOH B:481 , HOH B:486 , HOH B:492 , HOH B:501 , HOH B:502 , HOH B:542binding site for residue NDP B 302
5AC5SOFTWAREPHE C:94 , LYS C:95 , GLN C:105 , SER C:139 , MET C:141 , SER C:191 , ALA C:192 , TYR C:193 , MET C:234 , ALA C:235 , NDP C:302 , HOH C:443 , HOH C:453 , HOH C:507binding site for residue GSH C 301
6AC6SOFTWAREGLY C:11 , ASN C:13 , LYS C:14 , GLY C:15 , ILE C:16 , ARG C:37 , ARG C:41 , LEU C:61 , ASP C:62 , ILE C:63 , ASP C:64 , ASN C:89 , ALA C:90 , GLY C:91 , ILE C:92 , VAL C:137 , SER C:138 , SER C:139 , TYR C:193 , LYS C:197 , PRO C:227 , GLY C:228 , TRP C:229 , VAL C:230 , THR C:232 , MET C:234 , ALA C:235 , GSH C:301 , HOH C:431 , HOH C:434 , HOH C:436 , HOH C:454 , HOH C:468 , HOH C:470 , HOH C:475 , HOH C:478 , HOH C:539binding site for residue NDP C 302
7AC7SOFTWAREPHE D:94 , LYS D:95 , GLN D:105 , SER D:139 , SER D:191 , ALA D:192 , TYR D:193 , MET D:234 , ALA D:235 , NDP D:302 , HOH D:437 , HOH D:441binding site for residue GSH D 301
8AC8SOFTWAREGLY D:11 , ASN D:13 , LYS D:14 , GLY D:15 , ILE D:16 , ARG D:37 , ARG D:41 , LEU D:61 , ASP D:62 , ILE D:63 , ASP D:64 , ASN D:89 , ALA D:90 , GLY D:91 , ILE D:92 , VAL D:137 , SER D:138 , SER D:139 , TYR D:193 , LYS D:197 , PRO D:227 , GLY D:228 , TRP D:229 , VAL D:230 , THR D:232 , ASP D:233 , MET D:234 , ALA D:235 , GSH D:301 , HOH D:420 , HOH D:427 , HOH D:444 , HOH D:447 , HOH D:453 , HOH D:461 , HOH D:467 , HOH D:474 , HOH D:500 , HOH D:510binding site for residue NDP D 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4Z3D)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Gly A:262 -Pro A:263
2Gly B:262 -Pro B:263
3Gly C:3 -Ile C:4
4Gly C:262 -Pro C:263
5Gly D:262 -Pro D:263

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z3D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z3D)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z3D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:276
                                                                                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhhhhhh..eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeee..hhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee...............hhhhhhhhhhhhhh...........eee..eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z3d A   1 SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW 276
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270      


Chain B from PDB  Type:PROTEIN  Length:275
                                                                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee....hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eeee....hhhhhhhhhhhhhhhhh.eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeee..hhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee...............hhhhhhhhhhhhhh...........eee..eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z3d B   2 SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW 276
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271     


Chain C from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee....hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhhhhhhh.eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeee..hhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee...............hhhhhhhhhhhhhh...........eee..eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z3d C   3 GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW 276
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272    


Chain D from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee....hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eeee....hhhhhhhhhhhhhhhhh.eeeeee............hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee...............hhhhhhhhhhhhhh...........eee..eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z3d D   3 GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW 276
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z3D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z3D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z3D)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:262 - Pro A:263   [ RasMol ]  
    Gly B:262 - Pro B:263   [ RasMol ]  
    Gly C:262 - Pro C:263   [ RasMol ]  
    Gly C:3 - Ile C:4   [ RasMol ]  
    Gly D:262 - Pro D:263   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z3d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CBR1_HUMAN | P16152
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.184
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  1.1.1.189
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  1.1.1.197
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CBR1_HUMAN | P16152
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CBR1_HUMAN | P16152: 1wma 2pfg 3bhi 3bhj 3bhm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z3D)