Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF COTA LACCASE COMPLEXED WITH ABTS AT A NOVEL BINDING SITE
 
Authors :  Z. C. Liu, T. Xie, G. G. Wang
Date :  20 Mar 15  (Deposition) - 30 Mar 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Spore Coat Protein A, Oxidoreductase, Laccase, Abts (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Liu, T. Xie, Q. Zhong, G. Wang
Crystal Structure Of Cota Laccase Complexed With 2, 2-Azinobis-(3-Ethylbenzothiazoline-6-Sulfonate) At A Nove Binding Site
Acta Crystallogr. , Sect. F V. 72 328 2016
PubMed-ID: 27050268  |  Reference-DOI: 10.1107/S2053230X1600426X

(-) Compounds

Molecule 1 - SPORE COAT PROTEIN A
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX-6P-1
    Expression System Strain: DH5A
    Expression System Taxid: 562
    Gene: COTA, PIG, BSU06300
    Organism Scientific: BACILLUS SUBTILIS (STRAIN 168)
    Organism Taxid: 224308
    Strain: 168

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 10)

Asymmetric/Biological Unit (4, 10)
No.NameCountTypeFull Name
1CU3Ligand/IonCOPPER (II) ION
2EBS1Ligand/Ion3-ETHYL-2-[(2Z)-2-(3-ETHYL-6-SULFO-1,3-BENZOTHIAZOL-2(3H)-YLIDENE)HYDRAZINO]-6-SULFO-3H-1,3-BENZOTHIAZOL-1-IUM
3EDO5Ligand/Ion1,2-ETHANEDIOL
4GOL1Ligand/IonGLYCEROL

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:419 , CYS A:492 , HIS A:497 , MET A:502binding site for residue CU A 601
02AC2SOFTWAREHIS A:155 , HIS A:422 , HIS A:424 , HIS A:491 , HOH A:1008binding site for residue CU A 602
03AC3SOFTWAREHIS A:107 , HIS A:153 , HIS A:493 , HOH A:1008binding site for residue CU A 603
04AC4SOFTWAREPRO A:359 , SER A:360 , HIS A:363 , THR A:406 , ILE A:408 , ARG A:429 , LEU A:431 , TRP A:463 , ARG A:476 , ALA A:478 , ALA A:479 , THR A:480binding site for residue EBS A 604
05AC5SOFTWAREGLU A:188 , GLU A:244 , TYR A:250binding site for residue EDO A 605
06AC6SOFTWAREPHE A:292 , SER A:293 , TYR A:300 , SER A:459 , HOH A:880binding site for residue EDO A 606
07AC7SOFTWARESER A:266 , LEU A:267 , ASP A:268 , ALA A:317 , EDO A:608binding site for residue EDO A 607
08AC8SOFTWAREPRO A:328 , ALA A:332 , EDO A:607 , HOH A:778 , HOH A:876binding site for residue EDO A 608
09AC9SOFTWAREPRO A:483 , TYR A:484 , SER A:485 , ASP A:510binding site for residue EDO A 609
10AD1SOFTWAREASP A:113 , ASP A:114 , TYR A:118 , ALA A:121 , TYR A:133 , LYS A:135 , ARG A:487 , HOH A:882 , HOH A:924binding site for residue GOL A 610

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:229 -A:322

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Phe A:55 -Pro A:56
2Asn A:221 -Pro A:222
3Gly A:482 -Pro A:483
4Tyr A:500 -Asp A:501

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YVN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YVN)

(-) Exons   (0, 0)

(no "Exon" information available for 4YVN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:505
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................ee....eeeeeeeeeeee........eeeeee........eeee....eeeeeee........................eeee....hhhhh.......hhhhh.........eeee......eeeeeee....hhhhhhhh..eeeeeeehhhhhhhh..hhh.eeeeeeeeeee.....ee........................eeee..ee..eee....eeeeeeee......eeeee.....eeeeee..eeeeeeeee.eeee....eeeeeee.......eeeeee..............eeeeee...........................eeeeeeeeeeeee.....eeeee.................eeeeeeee.....eeeee....eeeeeeee.hhhhhhhhh...........hhhhh....eeee...eeeeeeee.....eeeeeee.hhhhhh...eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yvn A   2 TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP 511
                                    11        21        31        41        51        61        71        81        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506     
                                                                                                                   90|                                                                                                                                                                                                                                                                                                                                                                                                                               
                                                                                                                    96
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YVN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YVN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YVN)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EBS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:221 - Pro A:222   [ RasMol ]  
    Gly A:482 - Pro A:483   [ RasMol ]  
    Phe A:55 - Pro A:56   [ RasMol ]  
    Tyr A:500 - Asp A:501   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yvn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COTA_BACSU | P07788
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COTA_BACSU | P07788
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COTA_BACSU | P07788: 1gsk 1of0 1w6l 1w6w 1w8e 2bhf 2wsd 2x87 2x88 3zdw 4a66 4a67 4a68 4ako 4akp 4akq 4q89 4q8b 4yvu

(-) Related Entries Specified in the PDB File

4yvu