4YHA - JenaLib

Title :   CRYSTAL STRUCTURE OF THE COMPLEX OF HELICOBACTER PYLORI ALPHA-CARBONIC ANHYDRASE WITH METHAZOLAMIDE

Authors :   A. Roujeinikova, J. K. Modak

Date :   27 Feb 15 (Deposition) - 01 Jul 15 (Release) - 16 Dec 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)
Biol. Unit 4: G,H  (1x)

Keywords :   Zinc Metalloenzyme, Methazolamide, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. K. Modakh, Y. C. Liu, M. A. Machuca, C. T. Supuran, A. Roujeinikova
Structural Basis For The Inhibition Of Helicobacter Pylori Alpha-Carbonic Anhydrase By Sulfonamides.
Plos One V. 10 27149 2015
PubMed-ID: 26010545 | Reference-DOI: 10.1371/JOURNAL.PONE.0127149

Compounds

Molecule 1 - ALPHA-CARBONIC ANHYDRASE
	Chains	:	A, B, C, D, E, F, G, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	C694_06140
	Organism Scientific	:	HELICOBACTER PYLORI
	Organism Taxid	:	85962
	Strain	:	ATCC 700392 / 26695

Structural Features

Chains, Units

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F
Biological Unit 4 (1x)	:							G	H

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (4, 26)

Asymmetric Unit (4, 26)

No.	Name	Count	Type	Full Name
1	CL	6	Ligand/Ion	CHLORIDE ION
2	GOL	4	Ligand/Ion	GLYCEROL
3	MZM	8	Ligand/Ion	5-ACETAMIDO-4-METHYL-1,3,4-THIADIAZOLE-2-SULFONAMIDE
4	ZN	8	Ligand/Ion	ZINC ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	-1	Ligand/Ion	GLYCEROL
3	MZM	2	Ligand/Ion	5-ACETAMIDO-4-METHYL-1,3,4-THIADIAZOLE-2-SULFONAMIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	2	Ligand/Ion	GLYCEROL
3	MZM	2	Ligand/Ion	5-ACETAMIDO-4-METHYL-1,3,4-THIADIAZOLE-2-SULFONAMIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (2, 3)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	MZM	2	Ligand/Ion	5-ACETAMIDO-4-METHYL-1,3,4-THIADIAZOLE-2-SULFONAMIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 4 (2, 3)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	MZM	2	Ligand/Ion	5-ACETAMIDO-4-METHYL-1,3,4-THIADIAZOLE-2-SULFONAMIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Sites (26, 26)

Asymmetric Unit (26, 26)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HIS A:110 , HIS A:112 , HIS A:129 , MZM A:303	binding site for residue ZN A 301
02	AC2	SOFTWARE	MET A:115 , GLU A:116 , PHE A:117 , SER A:127 , HIS A:129	binding site for residue CL A 302
03	AC3	SOFTWARE	ASP A:107 , ASN A:108 , HIS A:110 , HIS A:112 , HIS A:129 , VAL A:131 , LEU A:190 , THR A:191 , PRO A:193 , TRP A:201 , ZN A:301	binding site for residue MZM A 303
04	AC4	SOFTWARE	HIS B:110 , HIS B:112 , HIS B:129 , MZM B:303	binding site for residue ZN B 301
05	AC5	SOFTWARE	MET B:115 , GLU B:116 , PHE B:117 , SER B:127	binding site for residue CL B 302
06	AC6	SOFTWARE	ASP B:107 , ASN B:108 , HIS B:110 , HIS B:112 , VAL B:131 , LEU B:190 , THR B:191 , ALA B:192 , PRO B:193 , ZN B:301	binding site for residue MZM B 303
07	AC7	SOFTWARE	HIS C:110 , HIS C:112 , HIS C:129 , MZM C:303	binding site for residue ZN C 301
08	AC8	SOFTWARE	MET C:115 , GLU C:116 , PHE C:117 , SER C:127 , HIS C:129	binding site for residue CL C 302
09	AC9	SOFTWARE	ASN C:108 , HIS C:110 , HIS C:112 , HIS C:129 , VAL C:131 , LEU C:190 , THR C:191 , TRP C:201 , ZN C:301 , GOL C:304	binding site for residue MZM C 303
10	AD1	SOFTWARE	MZM C:303 , HOH C:421	binding site for residue GOL C 304
11	AD2	SOFTWARE	HIS D:110 , HIS D:112 , HIS D:129 , MZM D:302	binding site for residue ZN D 301
12	AD3	SOFTWARE	LYS D:88 , ASN D:108 , HIS D:110 , HIS D:112 , HIS D:129 , VAL D:131 , LEU D:190 , THR D:191 , ALA D:192 , PRO D:193 , ZN D:301 , GOL D:303	binding site for residue MZM D 302
13	AD4	SOFTWARE	TYR D:25 , HIS D:84 , THR D:86 , HIS D:112 , MZM D:302	binding site for residue GOL D 303
14	AD5	SOFTWARE	HIS E:110 , HIS E:112 , HIS E:129 , MZM E:303	binding site for residue ZN E 301
15	AD6	SOFTWARE	MET E:115 , GLU E:116 , PHE E:117 , SER E:127 , HIS E:129	binding site for residue CL E 302
16	AD7	SOFTWARE	LYS E:88 , ASN E:108 , HIS E:110 , HIS E:112 , HIS E:129 , LEU E:190 , THR E:191 , ALA E:192 , PRO E:193 , TRP E:201 , ZN E:301 , GOL E:304	binding site for residue MZM E 303
17	AD8	SOFTWARE	LYS E:88 , HIS E:110 , ALA E:192 , MZM E:303	binding site for residue GOL E 304
18	AD9	SOFTWARE	HIS F:110 , HIS F:112 , HIS F:129 , THR F:191 , MZM F:302	binding site for residue ZN F 301
19	AE1	SOFTWARE	ASP F:107 , ASN F:108 , HIS F:110 , HIS F:112 , HIS F:129 , VAL F:131 , THR F:191 , ALA F:192 , ZN F:301	binding site for residue MZM F 302
20	AE2	SOFTWARE	HIS G:110 , HIS G:112 , HIS G:129 , MZM G:303	binding site for residue ZN G 301
21	AE3	SOFTWARE	PHE G:117 , SER G:127 , HIS G:129 , ALA G:143	binding site for residue CL G 302
22	AE4	SOFTWARE	LYS G:88 , ASN G:108 , HIS G:110 , HIS G:112 , HIS G:129 , VAL G:131 , LYS G:133 , LEU G:190 , THR G:191 , ALA G:192 , PRO G:193 , TRP G:201 , ZN G:301 , GOL G:304	binding site for residue MZM G 303
23	AE5	SOFTWARE	LYS G:88 , HIS G:110 , HIS G:112 , ALA G:192 , MZM G:303	binding site for residue GOL G 304
24	AE6	SOFTWARE	HIS H:110 , HIS H:112 , HIS H:129 , THR H:191 , MZM H:303	binding site for residue ZN H 301
25	AE7	SOFTWARE	MET H:115 , SER H:127 , HIS H:129	binding site for residue CL H 302
26	AE8	SOFTWARE	ASN H:108 , HIS H:110 , HIS H:112 , HIS H:129 , VAL H:131 , LEU H:190 , THR H:191 , ALA H:192 , PRO H:193 , ZN H:301	binding site for residue MZM H 303

SS Bonds (8, 8)

Cis Peptide Bonds (24, 24)

Asymmetric Unit

No.	Residues
1	Ser A:52	-	Pro A:53
2	Ala A:113	-	Pro A:114
3	Pro A:193	-	Pro A:194
4	Ser B:52	-	Pro B:53
5	Ala B:113	-	Pro B:114
6	Pro B:193	-	Pro B:194
7	Ser C:52	-	Pro C:53
8	Ala C:113	-	Pro C:114
9	Pro C:193	-	Pro C:194
10	Ser D:52	-	Pro D:53
11	Ala D:113	-	Pro D:114
12	Pro D:193	-	Pro D:194
13	Ser E:52	-	Pro E:53
14	Ala E:113	-	Pro E:114
15	Pro E:193	-	Pro E:194
16	Ser F:52	-	Pro F:53
17	Ala F:113	-	Pro F:114
18	Pro F:193	-	Pro F:194
19	Ser G:52	-	Pro G:53
20	Ala G:113	-	Pro G:114
21	Pro G:193	-	Pro G:194
22	Ser H:52	-	Pro H:53
23	Ala H:113	-	Pro H:114
24	Pro H:193	-	Pro H:194

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh......ee...ee......eeee.....eeeeeee..eeeeee....eeee...eeeeeeeeee.....ee......eeeeeeee.....eeeeeeeeee......hhhhhh.........hhhhhh..eeeeeeeeee.......eeeeeeeeeeeeeehhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha A  21 TKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160    || 172       182       192       202       212       222       232       242     
                                                                                                                                                                          165|                                                                               
                                                                                                                                                                           168

Chain B from PDB  Type:PROTEIN  Length:221
                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh......ee...ee...eeee..ee...eeeee..eeeee.....eeee..eeeeeeeeeee.....ee.......eeeeeee.....eeeeeeeeee...hhhhhhhhh.......eehhhhh..eeeeeeeeee.......eeeeeeee...eeehhhhhhhhhhh..................eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha B  21 TKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    30        40        50        60 ||     73        83        93       103       113       123       133       143       153       163|      176       186       196       206       216       226       236       246 
                                                                    62|                                                                                              163|                                                                                
                                                                     66                                                                                               167

Chain C from PDB  Type:PROTEIN  Length:227
                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh......ee...ee.......eee.......eeeee..eeeee.....eee....eeeeeeeeee.....ee......eeeeeeee.....eeeeeeeeee......hhhhhh...........hhhhhh..eeeeeeeeee.......eeeeeeeeeeeeeehhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha C  21 TKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain D from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh......ee...ee....eeee.......eeeee..eeeee.....eeee...eeeeeeeeee.....ee.......eeeeeee.....eeeeeeee.....hhhhhhhhh.......hhhhh...eeeeeeeeee.......eeeeeeeeeeee..hhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha D  23 WDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDDLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    32        42        52        62 ||     74        84        94       104       114       124       134       144       154       164||     178       188       198       208       218       228       238         
                                                                    64|                                                                                               165|                                                                             
                                                                     67                                                                                                170

Chain E from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh......ee...ee.....eee..ee...eeeee..eeeee.....eeee..eeeeeeeeeee.....ee......eeeeeeee.....eeeeeeeeee...hhhhhhhhh..........eehhhhh..eeeeeeeeee.......eeeeeeeeeeeeeehhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha E  21 TKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    30        40        50        60    ||  72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242     
                                                                       65|                                                                                                                                                                                   
                                                                        68

Chain F from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh......ee...ee......eeee.......eeeee..eeeee.....eeee..eeeeeeeeeee.....ee......eeeeeeee.....eeeeeeeee..hhhhh...............eeeeeeeeee.......eeeeeeeeeeeee..............................eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha F  23 WDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEENPNLDPILEGIQKKDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    32        42        52        62        72        82        92       102       112       122       132       142     ||154       164||     182       192       202       212       222       232       242     
                                                                                                                                                       148|           165|                                                                         
                                                                                                                                                        151            174

Chain G from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhh......ee...ee...eeee..ee...eeeee..eeeee.....eeee...eeeeeeeeee.....ee......eeeeeeee.....eeeeeeeeee...hhhhh..............eehhhhh..eeeeeeeeee.......eeeeeeeeeeeeeehhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha G  20 NTKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    29        39        49        59   ||   72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242     
                                                                      63|                                                                                                                                                                                    
                                                                       67

Chain H from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh......ee...ee......eeee.....eeeeeee..eeeeee....eeee...eeeeeeeeee.....ee......eeeeeeee.....eeeeeeeeee......hhhhhh...........hhhhhh..eeeeeeeeee.......eeeeeeeeeeeeeehhhhhhhhhhhh.................eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yha H  23 WDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR 247
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MZM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:113 - Pro A:114	[ RasMol ]
		Ala B:113 - Pro B:114	[ RasMol ]
		Ala C:113 - Pro C:114	[ RasMol ]
		Ala D:113 - Pro D:114	[ RasMol ]
		Ala E:113 - Pro E:114	[ RasMol ]
		Ala F:113 - Pro F:114	[ RasMol ]
		Ala G:113 - Pro G:114	[ RasMol ]
		Ala H:113 - Pro H:114	[ RasMol ]
		Pro A:193 - Pro A:194	[ RasMol ]
		Pro B:193 - Pro B:194	[ RasMol ]
		Pro C:193 - Pro C:194	[ RasMol ]
		Pro D:193 - Pro D:194	[ RasMol ]
		Pro E:193 - Pro E:194	[ RasMol ]
		Pro F:193 - Pro F:194	[ RasMol ]
		Pro G:193 - Pro G:194	[ RasMol ]
		Pro H:193 - Pro H:194	[ RasMol ]
		Ser A:52 - Pro A:53	[ RasMol ]
		Ser B:52 - Pro B:53	[ RasMol ]
		Ser C:52 - Pro C:53	[ RasMol ]
		Ser D:52 - Pro D:53	[ RasMol ]
		Ser E:52 - Pro E:53	[ RasMol ]
		Ser F:52 - Pro F:53	[ RasMol ]
		Ser G:52 - Pro G:53	[ RasMol ]
		Ser H:52 - Pro H:53	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4yha
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	A0A0M3KL20_H \| A0A0M3KL20
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	A0A0M3KL20_H \| A0A0M3KL20
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description