Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
(-)Biological Unit 13
(-)Biological Unit 14
(-)Biological Unit 15
(-)Biological Unit 16
(-)Biological Unit 17
(-)Biological Unit 18
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)
Image Biological Unit 13
Biological Unit 13  (Jmol Viewer)
Image Biological Unit 14
Biological Unit 14  (Jmol Viewer)
Image Biological Unit 15
Biological Unit 15  (Jmol Viewer)
Image Biological Unit 16
Biological Unit 16  (Jmol Viewer)
Image Biological Unit 17
Biological Unit 17  (Jmol Viewer)
Image Biological Unit 18
Biological Unit 18  (Jmol Viewer)

(-) Description

Title :  BETA2 CARBOHYDRATE BINDING MODULE (CBM) OF AMP-ACTIVATED PROTEIN KINASE (AMPK) IN COMPLEX WITH GLUCOSYL-BETA-CYCLODEXTRIN
 
Authors :  J. Mobbs, M. A. Gorman, M. W. Parker, P. R. Gooley, M. Griffin
Date :  24 Feb 15  (Deposition) - 01 Apr 15  (Release) - 03 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  I  (1x)
Biol. Unit 10:  J  (1x)
Biol. Unit 11:  K  (1x)
Biol. Unit 12:  L  (1x)
Biol. Unit 13:  M  (1x)
Biol. Unit 14:  N  (1x)
Biol. Unit 15:  O  (1x)
Biol. Unit 16:  P  (1x)
Biol. Unit 17:  Q  (1x)
Biol. Unit 18:  R  (1x)
Keywords :  Carbohydrate Binding Module (Cbm), Amp-Activated Protein Kinase (Ampk), Glycogen, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. I. Mobbs, A. Koay, A. Di Paolo, M. Bieri, E. J. Petrie, M. A. Gorman, L. Doughty, M. W. Parker, D. I. Stapleton, M. D. Griffin, P. R. Gooley
Determinants Of Oligosaccharide Specificity Of The Carbohydrate-Binding Modules Of Amp-Activated Protein Kinase.
Biochem. J. V. 468 245 2015
PubMed-ID: 25774984  |  Reference-DOI: 10.1042/BJ20150270

(-) Compounds

Molecule 1 - 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT BETA-2
    Chains: A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Cell Line: BL21 (DE3)
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 74-155
    Gene: PRKAB2
    Organism Common: RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: AMPK SUBUNIT BETA-2

 Structural Features

(-) Chains, Units

  123456789101112131415161718
Asymmetric Unit : ABCDEFGHIJKLMNOPQR
Biological Unit 1 (1x): A                 
Biological Unit 2 (1x):  B                
Biological Unit 3 (1x):   C               
Biological Unit 4 (1x):    D              
Biological Unit 5 (1x):     E             
Biological Unit 6 (1x):      F            
Biological Unit 7 (1x):       G           
Biological Unit 8 (1x):        H          
Biological Unit 9 (1x):         I         
Biological Unit 10 (1x):          J        
Biological Unit 11 (1x):           K       
Biological Unit 12 (1x):            L      
Biological Unit 13 (1x):             M     
Biological Unit 14 (1x):              N    
Biological Unit 15 (1x):               O   
Biological Unit 16 (1x):                P  
Biological Unit 17 (1x):                 Q 
Biological Unit 18 (1x):                  R

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 37)

Asymmetric Unit (2, 37)
No.NameCountTypeFull Name
14CQ18Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL19Ligand/IonGLYCEROL
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 3 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 5 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 6 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 7 (1, 1)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL-1Ligand/IonGLYCEROL
Biological Unit 8 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 9 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 10 (1, 1)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL-1Ligand/IonGLYCEROL
Biological Unit 11 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 12 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 13 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 14 (2, 3)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL2Ligand/IonGLYCEROL
Biological Unit 15 (1, 1)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL-1Ligand/IonGLYCEROL
Biological Unit 16 (2, 2)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL1Ligand/IonGLYCEROL
Biological Unit 17 (1, 1)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL-1Ligand/IonGLYCEROL
Biological Unit 18 (1, 1)
No.NameCountTypeFull Name
14CQ1Ligand/Ion6-O-ALPHA-D-GLUCOSYL-BETA-CYCLODEXTRIN
2GOL-1Ligand/IonGLYCEROL

(-) Sites  (37, 37)

Asymmetric Unit (37, 37)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREILE A:103 , PRO A:104 , ALA A:114 , ILE A:115 , LEU A:116 , HOH A:340 , HOH A:351 , HOH A:415 , ILE C:115binding site for residue GOL A 201
02AC2SOFTWAREGLU A:89 , VAL A:90 , PHE A:91 , LEU A:105 , HOH A:345 , HOH A:346 , HOH A:381 , THR G:101 , LYS G:102binding site for residue GOL A 202
03AC3SOFTWARESER A:93 , TRP A:99 , LYS A:102 , LYS A:126 , TRP A:133 , SER A:144 , GLN A:145 , THR A:148 , ASN A:150 , HOH A:304 , HOH A:305 , HOH A:308 , HOH A:341 , HOH A:349 , HOH A:353 , HOH A:356 , HOH A:361 , HOH A:422 , ASN F:98 , 4CQ F:202 , HOH F:301 , LYS G:88 , GLU G:89 , HOH G:340 , GLU L:120binding site for residue 4CQ A 203
04AC4SOFTWAREGLU B:89 , PHE B:91 , PHE B:128 , VAL B:129 , ASP B:130 , GLY B:131 , HOH B:313 , HOH B:386 , PHE F:91 , LYS F:102 , PHE F:128binding site for residue GOL B 201
05AC5SOFTWAREPRO B:104 , ILE B:115 , LEU B:116 , HOH B:301 , HOH B:315 , HOH B:399 , HOH B:400 , ILE L:115binding site for residue GOL B 202
06AC6SOFTWARESER B:93 , TRP B:99 , LYS B:102 , LYS B:126 , TRP B:133 , SER B:144 , GLN B:145 , THR B:148 , ASN B:150 , HOH B:340 , HOH B:348 , HOH B:349 , HOH B:354 , HOH B:361 , HOH B:362 , HOH B:363 , 4CQ E:202 , HOH E:327 , LYS F:88 , GLU F:89 , HOH F:366 , HOH F:384binding site for residue 4CQ B 203
07AC7SOFTWAREHOH A:383 , VAL C:80 , ILE C:81 , ARG C:82 , TYR C:125 , HOH C:324 , HOH C:326 , HOH C:410binding site for residue GOL C 201
08AC8SOFTWAREILE A:115 , HOH A:340 , ILE C:103 , PRO C:104 , ALA C:114 , ILE C:115 , HOH C:362 , HOH C:403binding site for residue GOL C 202
09AC9SOFTWARESER C:93 , TRP C:99 , LYS C:102 , LYS C:126 , TRP C:133 , SER C:144 , GLN C:145 , THR C:148 , ASN C:150 , HOH C:301 , HOH C:319 , HOH C:340 , HOH C:343 , HOH C:344 , HOH C:353 , HOH C:358 , HOH C:363 , HOH C:370 , HOH C:373 , HOH C:392 , HOH C:393 , HOH C:400 , LYS E:88 , GLU E:89 , HOH E:329 , 4CQ F:202binding site for residue 4CQ C 203
10AD1SOFTWAREILE D:103 , PRO D:104 , ALA D:114 , ILE D:115 , LEU D:116 , HOH D:351 , HOH D:354 , HOH D:388 , HOH D:399 , ILE K:115binding site for residue GOL D 201
11AD2SOFTWARESER D:93 , TRP D:99 , LYS D:102 , LYS D:126 , TRP D:133 , SER D:144 , GLN D:145 , LEU D:146 , THR D:148 , ASN D:150 , HOH D:344 , HOH D:349 , HOH D:360 , HOH D:367 , HOH D:371 , HOH D:381 , HOH D:386 , HOH D:390 , HOH D:396 , GLU H:120 , HOH H:305 , HOH H:306 , HOH H:307 , LYS N:88 , GLU N:89binding site for residue 4CQ D 202
12AD3SOFTWAREVAL E:80 , ILE E:81 , ARG E:82 , GLU E:139 , HOH E:303 , HIS I:109 , HOH I:350binding site for residue GOL E 201
13AD4SOFTWAREGLN B:132 , 4CQ B:203 , SER E:93 , TRP E:99 , LYS E:102 , LYS E:126 , TRP E:133 , SER E:144 , GLN E:145 , LEU E:146 , THR E:148 , ASN E:150 , HOH E:327 , HOH E:332 , HOH E:335 , HOH E:344 , HOH E:353 , HOH E:358 , HOH E:360 , HOH E:366 , HOH E:367 , HOH E:375 , HOH E:386 , HOH E:392 , 4CQ N:203binding site for residue 4CQ E 202
14AD5SOFTWAREILE F:81 , ARG F:82 , GLU F:139 , HOH F:324 , HIS J:109binding site for residue GOL F 201
15AD6SOFTWARE4CQ A:203 , LYS B:88 , GLN C:132 , 4CQ C:203 , HOH C:344 , HOH C:392 , TRP F:99 , LYS F:126 , TRP F:133 , SER F:144 , GLN F:145 , LEU F:146 , THR F:148 , ASN F:150 , HOH F:301 , HOH F:306 , HOH F:308 , HOH F:314 , HOH F:325 , HOH F:344 , HOH F:350 , HOH F:355 , HOH F:364 , HOH F:368 , HOH F:377 , HOH F:378 , HOH F:380 , HOH F:388 , HOH F:390 , HOH F:391 , HOH F:393binding site for residue 4CQ F 202
16AD7SOFTWAREGLU A:89 , HOH A:381 , TRP G:99 , LYS G:102 , LYS G:126 , TRP G:133 , SER G:144 , GLN G:145 , THR G:148 , ASN G:150 , HOH G:331 , HOH G:336 , HOH G:342 , HOH G:351 , HOH G:356 , HOH G:359 , HOH G:384 , HOH G:385 , GLU N:120binding site for residue 4CQ G 201
17AD8SOFTWAREVAL H:80 , ARG H:82 , TYR H:125 , PHE H:127 , ASP H:136 , GLU H:139 , HOH H:312 , HIS P:109 , HOH P:319binding site for residue GOL H 201
18AD9SOFTWARELYS H:88 , GLU H:89 , ASP H:130 , GLY L:131 , TRP L:133binding site for residue GOL H 202
19AE1SOFTWAREGLU G:120 , SER H:93 , TRP H:99 , THR H:101 , LYS H:102 , LYS H:126 , TRP H:133 , SER H:144 , GLN H:145 , THR H:148 , ASN H:150 , HOH H:304 , HOH H:341 , HOH H:343 , HOH H:386 , GLU L:89binding site for residue 4CQ H 203
20AE2SOFTWAREHIS E:109 , HOH E:384 , VAL I:80 , ILE I:81 , ARG I:82 , GLU I:139 , HOH I:342binding site for residue GOL I 201
21AE3SOFTWAREILE E:115 , ILE I:103 , PRO I:104 , ILE I:106 , ALA I:114 , ILE I:115 , HOH I:315 , HOH I:317 , HOH I:345 , HOH I:377binding site for residue GOL I 202
22AE4SOFTWARESER I:93 , TRP I:99 , LYS I:102 , LYS I:126 , TRP I:133 , SER I:144 , GLN I:145 , LEU I:146 , THR I:148 , ASN I:150 , HOH I:335 , HOH I:340 , HOH I:344 , GLY P:131 , GLN P:132binding site for residue 4CQ I 203
23AE5SOFTWARETRP J:99 , LYS J:102 , LYS J:126 , TRP J:133 , SER J:144 , GLN J:145 , LEU J:146 , THR J:148 , ASN J:150 , HOH J:345 , HOH J:346 , HOH J:349 , HOH J:352 , HOH J:377 , GLN M:132 , HOH M:302binding site for residue 4CQ J 201
24AE6SOFTWAREGLU K:89 , VAL K:90 , PHE K:91 , PRO K:104 , LEU K:105 , HOH K:309 , HOH K:310 , HOH K:343 , THR R:101 , HOH R:309binding site for residue GOL K 201
25AE7SOFTWARESER K:93 , TRP K:99 , LYS K:102 , LYS K:126 , TRP K:133 , SER K:144 , GLN K:145 , LEU K:146 , THR K:148 , ASN K:150 , HOH K:311 , HOH K:341 , HOH K:346 , HOH K:352 , LYS R:88 , GLU R:89 , 4CQ R:201 , HOH R:301 , HOH R:304binding site for residue 4CQ K 202
26AE8SOFTWAREILE B:115 , HOH B:315 , ILE L:103 , PRO L:104 , ALA L:114 , ILE L:115 , LEU L:116 , HOH L:356 , HOH P:306binding site for residue GOL L 201
27AE9SOFTWAREGLU D:120 , HIS D:154 , LYS D:156 , LYS H:88 , GLU H:89 , HOH H:358 , SER L:93 , TRP L:99 , THR L:101 , LYS L:102 , LYS L:126 , TRP L:133 , SER L:144 , GLN L:145 , THR L:148 , ASN L:150 , HOH L:331 , HOH L:332 , HOH L:339 , HOH L:350 , HOH L:362 , HOH L:371binding site for residue 4CQ L 202
28AF1SOFTWAREILE M:103 , PRO M:104 , ALA M:114 , ILE M:115 , LEU M:116 , HOH M:394binding site for residue GOL M 201
29AF2SOFTWARETRP M:99 , LYS M:102 , LYS M:126 , TRP M:133 , SER M:144 , GLN M:145 , LEU M:146 , THR M:148 , ASN M:150 , HOH M:329 , HOH M:350 , HOH M:351 , HOH M:353 , HOH M:376 , HOH M:391 , HOH M:398 , HOH M:411binding site for residue 4CQ M 202
30AF3SOFTWAREILE N:81 , ARG N:82 , GLU N:139 , HOH N:304 , HOH N:352 , HIS O:109 , HOH O:326binding site for residue GOL N 201
31AF4SOFTWAREHIS N:109 , HOH N:305 , HOH N:317 , VAL O:80 , ILE O:81 , ARG O:82 , GLU O:139binding site for residue GOL N 202
32AF5SOFTWARELYS A:156 , GLU D:89 , ASN E:98 , 4CQ E:202 , TRP N:99 , SER N:100 , THR N:101 , LYS N:102 , LYS N:126 , TRP N:133 , SER N:144 , GLN N:145 , THR N:148 , ASN N:150 , HOH N:330 , HOH N:345 , HOH N:369binding site for residue 4CQ N 203
33AF6SOFTWARELYS F:156 , SER O:93 , TRP O:99 , SER O:100 , LYS O:102 , LYS O:126 , TRP O:133 , SER O:144 , GLN O:145 , LEU O:146 , THR O:148 , ASN O:150 , HOH O:302 , HOH O:327 , HOH O:364 , HOH O:366 , HOH O:367 , HOH O:389 , HOH O:390 , HOH Q:302binding site for residue 4CQ O 201
34AF7SOFTWAREILE H:115 , ILE P:103 , PRO P:104 , ILE P:106 , ALA P:114 , ILE P:115 , HOH P:307binding site for residue GOL P 201
35AF8SOFTWARESER P:93 , TRP P:99 , LYS P:102 , LYS P:126 , TRP P:133 , SER P:144 , GLN P:145 , LEU P:146 , THR P:148 , ASN P:150 , HOH P:343 , HOH P:371 , HOH P:372binding site for residue 4CQ P 202
36AF9SOFTWAREGLN O:132 , SER Q:93 , TRP Q:99 , LYS Q:102 , LYS Q:126 , TRP Q:133 , SER Q:144 , GLN Q:145 , LEU Q:146 , THR Q:148 , ASN Q:150 , HOH Q:311 , HOH Q:314 , HOH Q:327 , HOH Q:332 , HOH Q:352 , HOH Q:354 , HOH Q:365 , HOH Q:368 , HOH Q:373binding site for residue 4CQ Q 201
37AG1SOFTWAREGLN K:132 , 4CQ K:202 , SER R:93 , TRP R:99 , LYS R:102 , LYS R:126 , TRP R:133 , SER R:144 , GLN R:145 , LEU R:146 , THR R:148 , ASN R:150 , HOH R:302 , HOH R:304 , HOH R:305 , HOH R:317 , HOH R:336 , HOH R:341 , HOH R:354binding site for residue 4CQ R 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YEE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YEE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YEE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YEE)

(-) Exons   (0, 0)

(no "Exon" information available for 4YEE)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:82
                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 4yee A  75 QARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    84        94       104       114       124       134       144       154  


Chain B from PDB  Type:PROTEIN  Length:83
                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee......eeeee.hhh....ee.eee..eeeeee....eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                 4yee B  74 SQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    83        93       103       113       123       133       143       153   


Chain C from PDB  Type:PROTEIN  Length:83
                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee......eeeee.hhh....ee.eee..eeeeee....eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                 4yee C  74 SQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    83        93       103       113       123       133       143       153   


Chain D from PDB  Type:PROTEIN  Length:79
                                                                                                               
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......eeeee.hhh....ee.eee..eeeeee....eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 4yee D  78 PTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    87        97       107       117       127       137       147         


Chain E from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee E  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain F from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee F  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain G from PDB  Type:PROTEIN  Length:83
                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                 4yee G  74 SQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    83        93       103       113       123       133       143       153   


Chain H from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee H  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain I from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee I  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain J from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee J  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain K from PDB  Type:PROTEIN  Length:82
                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 4yee K  75 QARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    84        94       104       114       124       134       144       154  


Chain L from PDB  Type:PROTEIN  Length:82
                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee......eeeee.hhh....eeeeee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 4yee L  75 QARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    84        94       104       114       124       134       144       154  


Chain M from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee M  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain N from PDB  Type:PROTEIN  Length:84
                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 4yee N  73 NSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    82        92       102       112       122       132       142       152    


Chain O from PDB  Type:PROTEIN  Length:84
                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 4yee O  73 NSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    82        92       102       112       122       132       142       152    


Chain P from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4yee P  72 PNSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    81        91       101       111       121       131       141       151     


Chain Q from PDB  Type:PROTEIN  Length:84
                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 4yee Q  73 NSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    82        92       102       112       122       132       142       152    


Chain R from PDB  Type:PROTEIN  Length:84
                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee......eeeee.hhh....ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 4yee R  73 NSQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK 156
                                    82        92       102       112       122       132       142       152
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YEE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YEE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YEE)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4CQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4yee)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]
    Biological Unit 13  [ Jena3D ]
    Biological Unit 14  [ Jena3D ]
    Biological Unit 15  [ Jena3D ]
    Biological Unit 16  [ Jena3D ]
    Biological Unit 17  [ Jena3D ]
    Biological Unit 18  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format | Biol. Unit 7 PNG format | Biol. Unit 8 PNG format | Biol. Unit 9 PNG format | Biol. Unit 10 PNG format | Biol. Unit 11 PNG format | Biol. Unit 12 PNG format | Biol. Unit 13 PNG format | Biol. Unit 14 PNG format | Biol. Unit 15 PNG format | Biol. Unit 16 PNG format | Biol. Unit 17 PNG format | Biol. Unit 18 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yee
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAKB2_RAT | Q9QZH4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AAKB2_RAT | Q9QZH4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAKB2_RAT | Q9QZH4: 2lu3 2lu4 4y0g

(-) Related Entries Specified in the PDB File

4yef