Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  WILD-TYPE FULL LENGTH MIS16 IN SCHIZOSACCHAROMYCES JAPONICUS
 
Authors :  S. An, H. Kim, U. -S. Cho
Date :  02 Feb 15  (Deposition) - 13 Jan 16  (Release) - 17 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Centromere, Cenp-A, Kinetochore, Mis18 Complex, Histone, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. An, H. Kim, U. S. Cho
Mis16 Independently Recognizes Histone H4 And The Cenp-Acnp1-Specific Chaperone Scm3Sp.
J. Mol. Biol. V. 427 3230 2015
PubMed-ID: 26343758  |  Reference-DOI: 10.1016/J.JMB.2015.08.022

(-) Compounds

Molecule 1 - KINETOCHORE PROTEIN MIS16
    ChainsA
    EngineeredYES
    Expression SystemBACULOVIRUS EXPRESSION VECTOR PFASTBAC1-HM
    Expression System Cell LineHI-5
    Expression System PlasmidPFASTBAC HTB
    Expression System Taxid274590
    GeneSJAG_03867
    Organism CommonFISSION YEAST
    Organism ScientificSCHIZOSACCHAROMYCES JAPONICUS (STRAIN YFS275 / FY16936)
    Organism Taxid402676
    StrainYFS275 / FY16936

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4XYH)

(-) Sites  (0, 0)

(no "Site" information available for 4XYH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4XYH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4XYH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XYH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XYH)

(-) Exons   (0, 0)

(no "Exon" information available for 4XYH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:375
                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhheeeeeeee.......eee.......eeeeeeee.........eeeeeeeeeee..eeeeeeee.....eeeee..eeeeeeee.hhh.eeeee.hhh....ee.....eee........eeee......eeeee.....eeeee...........eee...eee......eeeeee......eeeeee...eeeeee..........eeee.....eeeeee......eeeeee....eeeee........eee......eeeeee......eeeeee....eeeee.hhh....hhhhhh.....eeeee......eeeeee.......eeeee...eeeeeeehhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xyh A  14 LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA 415
                                    23        33        43        53      ||67        77        87       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410     
                                                                         60|                            95|                                                                                                                                                                                                                                                                                                        
                                                                          65                            119                                                                                                                                                                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XYH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XYH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XYH)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4xyh)
 
  Sites
(no "Sites" information available for 4xyh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4xyh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xyh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B6K598_SCHJY | B6K598
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  B6K598_SCHJY | B6K598
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B6K598_SCHJY | B6K5984xyi

(-) Related Entries Specified in the PDB File

4xyi