Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A TRAP PERIPLASMIC SOLUTE BINDING PROTEIN FROM CHROMOHALOBACTER SALEXIGENS DSM 3043 (CSAL_0678), TARGET EFI-501078, WITH BOUND (S)-(+)-2-AMINO-1-PROPANOL.
 
Authors :  M. W. Vetting, N. F. Al Obaidi, R. Toro, L. L. Morisco, J. Benach, S. R. Wa J. D. Attonito, A. Scott Glenn, S. Chamala, S. Chowdhury, J. Lafleur, R. D. Seidel, K. L. Whalen, J. A. Gerlt, S. C. Almo, Enzyme Function In (Efi)
Date :  26 Dec 14  (Deposition) - 28 Jan 15  (Release) - 07 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Trap Periplasmic Solute Binding Family, Enzyme Function Initiative, Efi, Structural Genomics, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. W. Vetting, N. F. Al Obaidi, R. Toro, L. L. Morisco, J. Benach, S. R. Wasserman, J. D. Attonito, A. Scott Glenn, S. Chamala, S. Chowdhury, J. Lafleur, J. Love, R. D. Seidel, K. L. Whalen, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative (Efi)
Crystal Structure Of A Trap Periplasmic Solute Binding Protein From Chromohalobacter Salexigens Dsm 3043 (Csal_0678), Target Efi-501078, With Bound (S)-(+)-2-Amino-1-Propanol.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 27-350
    Gene: CSAL_0678
    Organism Scientific: CHROMOHALOBACTER SALEXIGENS (STRAIN DSM 3043 / ATCC BAA-138 / NCIMB 13768)
    Organism Taxid: 290398
    Strain: DSM 3043 / ATCC BAA-138 / NCIMB 13768

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
12A12Ligand/Ion(2S)-2-AMINOPROPAN-1-OL
2CL4Ligand/IonCHLORIDE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:50 , ALA A:51 , PRO A:53 , ALA A:54 , SER A:271 , HOH A:563binding site for residue CL A 401
2AC2SOFTWARELYS A:134 , ALA A:151binding site for residue CL A 402
3AC3SOFTWARETYR A:41 , LEU A:46 , TYR A:113 , TRP A:154 , ASP A:155 , PHE A:179 , TRP A:215 , SER A:216 , GLU A:220 , TRP A:242binding site for residue 2A1 A 403
4AC4SOFTWAREVAL B:50 , ALA B:51 , PRO B:53 , ALA B:54 , SER B:271 , HOH B:596binding site for residue CL B 401
5AC5SOFTWARELYS B:134 , ALA B:151binding site for residue CL B 402
6AC6SOFTWARETYR B:41 , LEU B:46 , TYR B:113 , TRP B:154 , ASP B:155 , PHE B:179 , TRP B:215 , SER B:216 , GLU B:220 , TRP B:242binding site for residue 2A1 B 403

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4XF5)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Arg A:343 -Pro A:344
2Thr B:207 -Gly B:208
3Arg B:343 -Pro B:344

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XF5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XF5)

(-) Exons   (0, 0)

(no "Exon" information available for 4XF5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..hhhhhhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhh....eeeehhhhhh....hhhhh..........hhhhhhhhhhhhhhhhhhhhhh..eeeeeeee....eeee.....hhhhhh..eee.hhhhhhhhhh...eee..hhhhhhhhhhh....eeeeehhhhhhhhhhhhh..eee........eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xf5 A  32 PTIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRYV 348
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       


Chain B from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..hhhhhhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhh....eeee..........hhhhh..........hhhhhhhhhhhhhhhhhhhhhh..eeeeeeee....eeee.....hhhhhh..eee.hhhhhhhhhhhh.eee..hhhhhhhhhhh....eeeeehhhhhhhhhhhhh..eee........eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xf5 B  32 PTIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRYV 348
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XF5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XF5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XF5)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2A1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:343 - Pro A:344   [ RasMol ]  
    Arg B:343 - Pro B:344   [ RasMol ]  
    Thr B:207 - Gly B:208   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xf5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1QZR9_CHRSD | Q1QZR9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q1QZR9_CHRSD | Q1QZR9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q1QZR9_CHRSD | Q1QZR9: 4uab

(-) Related Entries Specified in the PDB File

4xeq 4xfe