Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF A PUTATIVE ARYL ESTERASE FROM BURKHOLDERIA CENOCEPACIA
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  20 Nov 14  (Deposition) - 03 Dec 14  (Release) - 03 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.38
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Hydrolase, Aryl Esterase, Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Ssgcid (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. W. Fairman, T. E. Edwards, D. Lorimer
X-Ray Crystal Structure Of A Putative Aryl Esterase From Burkholderia Cenocepacia
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE HYDROLASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 28-302
    Gene: BCAL2527
    Organism Scientific: BURKHOLDERIA CENOCEPACIA
    Organism Taxid: 216591
    Strain: ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 20)

Asymmetric Unit (3, 20)
No.NameCountTypeFull Name
1EDO14Ligand/Ion1,2-ETHANEDIOL
2F3Ligand/IonFLUORIDE ION
3GOL3Ligand/IonGLYCEROL
Biological Unit 1 (2, 8)
No.NameCountTypeFull Name
1EDO7Ligand/Ion1,2-ETHANEDIOL
2F-1Ligand/IonFLUORIDE ION
3GOL1Ligand/IonGLYCEROL
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1EDO3Ligand/Ion1,2-ETHANEDIOL
2F-1Ligand/IonFLUORIDE ION
3GOL-1Ligand/IonGLYCEROL
Biological Unit 3 (2, 3)
No.NameCountTypeFull Name
1EDO2Ligand/Ion1,2-ETHANEDIOL
2F-1Ligand/IonFLUORIDE ION
3GOL1Ligand/IonGLYCEROL
Biological Unit 4 (2, 3)
No.NameCountTypeFull Name
1EDO2Ligand/Ion1,2-ETHANEDIOL
2F-1Ligand/IonFLUORIDE ION
3GOL1Ligand/IonGLYCEROL

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:187 , HOH A:415 , HOH A:438 , HOH A:744 , ARG D:170 , ARG D:174binding site for residue EDO A 301
02AC2SOFTWARELEU A:48 , SER A:51 , LEU A:263 , HOH A:662 , HOH A:756binding site for residue EDO A 302
03AC3SOFTWAREALA A:228 , ASP A:230 , VAL A:233 , LYS A:234 , ALA A:235 , HOH A:525 , HOH A:617binding site for residue EDO A 303
04AC4SOFTWAREGLU A:252 , ARG A:268 , ARG A:271 , ASP A:272 , HOH A:421 , GLU D:99binding site for residue EDO A 304
05AC5SOFTWAREHOH A:406 , HOH A:411 , ILE D:98 , GLU D:99 , TYR D:121 , TYR D:125binding site for residue EDO A 305
06AC6SOFTWAREASP A:275 , ARG A:278 , HOH A:417 , HOH A:428 , PRO D:19 , ASP D:20binding site for residue EDO A 306
07AC7SOFTWARELYS A:52 , ARG A:179 , PRO A:181 , LEU A:263 , HOH A:566binding site for residue EDO A 307
08AC8SOFTWARESER A:112 , LEU A:232binding site for residue GOL A 308
09AC9SOFTWAREALA B:228 , ASP B:230 , VAL B:233 , LYS B:234 , ALA B:235 , HOH B:508 , HOH B:585 , HOH B:591binding site for residue EDO B 301
10AD1SOFTWARELYS B:77 , ALA B:194 , LEU B:195 , ALA B:196 , LEU C:195binding site for residue EDO B 302
11AD2SOFTWAREILE B:98 , GLU B:99 , TYR B:121 , TYR B:125 , HOH B:404 , ARG C:268 , HOH C:415binding site for residue EDO B 303
12AD3SOFTWARESER C:187binding site for residue F B 304
13AD4SOFTWAREALA C:228 , ASP C:230 , VAL C:233 , LYS C:234 , ALA C:235 , HOH C:517 , HOH C:581binding site for residue EDO C 301
14AD5SOFTWAREGLU B:99 , GLU C:252 , TYR C:254 , ARG C:268 , ARG C:271 , ASP C:272 , HOH C:404binding site for residue EDO C 302
15AD6SOFTWAREHIS C:150 , PRO C:151 , GLU C:152 , VAL C:153 , HOH C:695binding site for residue GOL C 303
16AD7SOFTWARESER B:187 , ARG C:174binding site for residue F C 304
17AD8SOFTWARELEU D:48 , ASN D:49 , SER D:51 , LEU D:188 , LEU D:263 , HOH D:564binding site for residue EDO D 301
18AD9SOFTWARETYR A:254 , ALA A:255 , ASP A:256 , GLU A:265 , ARG A:268 , ILE D:98 , GLU D:99 , HOH D:402 , HOH D:441binding site for residue EDO D 302
19AE1SOFTWARESER D:112 , TYR D:154 , HOH D:600binding site for residue GOL D 303
20AE2SOFTWARESER D:187binding site for residue F D 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4X00)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4X00)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X00)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X00)

(-) Exons   (0, 0)

(no "Exon" information available for 4X00)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:273
                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....eeeeeeee.....eeeee.....hhhhhhhhhhhhhhh..eeeee.............hhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhh.....eeeee.............hhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.hhhhhhhhh....hhhhhhhh....eeeeee......hhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x00 A  11 ARDYTVTAPDGVVLAVQEAGDPEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEASSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIAGAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMALSR 283
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   


Chain B from PDB  Type:PROTEIN  Length:272
                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeeeeee.....eeeee.....hhhhhhhhhh..hhhh.eeeee.............hhhhhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhh.....eeeee.............hhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhh...eeeeee......hhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x00 B  12 RDYTVTAPDGVVLAVQEAGDPEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEASSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIAGAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMALSR 283
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281  


Chain C from PDB  Type:PROTEIN  Length:273
                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....eeeeeeee.....eeeee.....hhhhhhhhhh..hhhh.eeeee.............hhhhhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhh.....eeeee.............hhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhh...eeeeee......hhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x00 C  11 ARDYTVTAPDGVVLAVQEAGDPEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEASSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIAGAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMALSR 283
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   


Chain D from PDB  Type:PROTEIN  Length:272
                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeeeeee.....eeeee.....hhhhhhhhhh..hhhh.eeeee.............hhhhhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhh.....eeeee.............hhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.hhhhhhhhh....hhhhhhhhh...eeeeee......hhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x00 D  12 RDYTVTAPDGVVLAVQEAGDPEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEASSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIAGAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMALSR 283
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X00)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X00)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X00)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    F  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4x00)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x00
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B4E794_BURCJ | B4E794
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B4E794_BURCJ | B4E794
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4X00)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4X00)