Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CATALYTIC DOMAIN OF THE MAJOR ENDOGLUCANASE FROM XANTHOMONAS CAMPESTRIS PV. CAMPESTRIS
 
Authors :  A. C. Puhl, F. R. Rosseto, I. Polikarpov
Date :  24 Jun 14  (Deposition) - 14 Oct 15  (Release) - 14 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Endoglucanase Tim Barrel Folding, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. C. Puhl, F. R. Rosseto, I. Stankovic, T. M. Alvarez, F. M. Squina, M. S. Skaf, I. Polikarpov
Substrate Cleavage Pattern, Biophysical Characterization An Crystallographic Structure Of The Major Endoglucanase From Xanthomonas Campestris Pv. Campestris
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - MAJOR EXTRACELLULAR ENDOGLUCANASE
    Chains: A, B, C, D
    EC Number: 3.2.1.4
    Fragment: UNP RESIDUES 26-371
    Organism Scientific: XANTHOMONAS CAMPESTRIS PV. CAMPESTRIS
    Organism Taxid: 190485
    Strain: ATCC 33913 / NCPPB 528 / LMG 568
    Synonym: CELLULASE,ENDO-1,4-BETA-GLUCANASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 27)

Asymmetric Unit (1, 27)
No.NameCountTypeFull Name
12HP27Ligand/IonDIHYDROGENPHOSPHATE ION
Biological Unit 1 (1, 7)
No.NameCountTypeFull Name
12HP7Ligand/IonDIHYDROGENPHOSPHATE ION
Biological Unit 2 (1, 8)
No.NameCountTypeFull Name
12HP8Ligand/IonDIHYDROGENPHOSPHATE ION
Biological Unit 3 (1, 8)
No.NameCountTypeFull Name
12HP8Ligand/IonDIHYDROGENPHOSPHATE ION
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
12HP4Ligand/IonDIHYDROGENPHOSPHATE ION

(-) Sites  (27, 27)

Asymmetric Unit (27, 27)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELYS A:68 , ASP A:107 , LYS A:119binding site for residue 2HP A 401
02AC2SOFTWARESER A:27 , ASN A:254 , ARG A:255 , HOH A:537binding site for residue 2HP A 402
03AC3SOFTWAREARG A:92 , GLN A:156 , ASP A:160 , 2HP A:407 , HOH A:507 , CYS B:229binding site for residue 2HP A 403
04AC4SOFTWAREGLY A:192 , ASN A:193 , ALA A:194 , ASP A:197 , LYS A:200 , HOH A:536 , HOH A:543binding site for residue 2HP A 404
05AC5SOFTWAREPHE A:293 , THR A:296 , HIS A:297 , HOH A:567 , HOH A:579 , ASN C:166binding site for residue 2HP A 405
06AC6SOFTWAREASP A:139 , ALA A:141 , GLY A:142 , HOH A:561 , HOH A:584 , TRP B:237binding site for residue 2HP A 406
07AC7SOFTWARELEU A:91 , ARG A:92 , ASP A:160 , 2HP A:403 , CYS B:229 , CYS B:246binding site for residue 2HP A 407
08AC8SOFTWAREARG B:65 , ASN B:66 , ASP B:69 , ARG D:65 , ASN D:66 , ASP D:69binding site for residue 2HP B 401
09AC9SOFTWARELYS B:68 , ASP B:107 , HOH B:568 , 2HP D:404binding site for residue 2HP B 402
10AD1SOFTWAREARG A:162 , GLY B:190 , GLY B:192 , ASP B:197 , ASN B:199 , LYS B:200 , THR B:247 , 2HP B:408 , HOH B:504binding site for residue 2HP B 403
11AD2SOFTWAREASP B:101 , SER B:103 , ARG B:104 , HOH B:503 , 2HP D:401binding site for residue 2HP B 404
12AD3SOFTWAREHIS B:136 , ILE B:143 , ASN B:181 , GLU B:182 , GLU B:303 , TRP B:337binding site for residue 2HP B 405
13AD4SOFTWAREILE A:143 , HIS A:184 , GLU B:145 , HIS B:184 , TRP B:237binding site for residue 2HP B 406
14AD5SOFTWARETRP A:237 , ASP B:139 , ALA B:141 , GLY B:142 , HOH B:542binding site for residue 2HP B 407
15AD6SOFTWAREGLY B:192 , ALA B:194 , ASP B:197 , LYS B:200 , 2HP B:403 , HOH B:556binding site for residue 2HP B 408
16AD7SOFTWAREGLY C:192 , ASN C:193 , ALA C:194 , ASP C:197 , LYS C:200 , HOH C:519binding site for residue 2HP C 401
17AD8SOFTWARELYS C:68 , ASP C:107 , LYS C:119binding site for residue 2HP C 402
18AD9SOFTWAREHIS C:136 , ILE C:143 , ASN C:181 , GLU C:182 , GLU C:303 , TRP C:337binding site for residue 2HP C 403
19AE1SOFTWAREGLU C:310 , ARG C:351 , ASP C:352 , ARG C:358binding site for residue 2HP C 404
20AE2SOFTWARECYS A:229 , LEU C:91 , ARG C:92 , ASP C:160 , PHE C:163binding site for residue 2HP C 405
21AE3SOFTWAREASP C:139 , GLY C:142 , SER C:144 , 2HP C:407 , 2HP C:408 , HOH C:529 , GLU D:145 , HIS D:184binding site for residue 2HP C 406
22AE4SOFTWAREASP C:139 , ALA C:141 , GLY C:142 , 2HP C:406 , HOH C:529 , TRP D:237binding site for residue 2HP C 407
23AE5SOFTWAREILE C:143 , GLU C:145 , HIS C:184 , TRP C:237 , 2HP C:406 , ILE D:143 , GLU D:145 , HIS D:184binding site for residue 2HP C 408
24AE6SOFTWARE2HP B:404 , LYS D:68 , ASP D:107binding site for residue 2HP D 401
25AE7SOFTWAREHIS D:136 , ILE D:143 , ASN D:181 , GLU D:182 , GLU D:303 , TRP D:337binding site for residue 2HP D 402
26AE8SOFTWAREGLY D:192 , ASN D:193 , ALA D:194 , ASP D:197 , LYS D:200 , HOH D:514binding site for residue 2HP D 403
27AE9SOFTWARELYS B:68 , 2HP B:402 , ASP D:101 , SER D:103 , ARG D:104binding site for residue 2HP D 404

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:87 -A:140
2A:229 -A:246
3B:87 -B:140
4B:229 -B:246
5C:87 -C:140
6C:229 -C:246
7D:87 -D:140
8D:229 -D:246

(-) Cis Peptide Bonds  (8, 9)

Asymmetric Unit
No.Residues
1Phe A:278 -Pro A:279
2Trp A:337 -Ser A:338
3Phe B:278 -Pro B:279
4Trp B:337 -Ser B:338
5Phe C:278 -Pro C:279
6Trp C:337 -Ser C:338
7Phe D:278 -Pro D:279
8Trp D:337 -Ser D:338

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TUF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TUF)

(-) Exons   (0, 0)

(no "Exon" information available for 4TUF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.....ee.....ee..eeee.................hhhhhhhhhhhh...eeeeeehhhhhh............hhhhh..hhhhhhhhhhhhhhhhh.eeeeee.................hhhhhhhhhhhhhhhhh....eeeee..................hhhhhhhhhhhhhhhhh...eeee....................hhhhhh.........eee..eee......hhhhhh.....hhhhhhhhhhhhhh......eeeee......hhhhhhhhhhhhhhhhhh....eee.....................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuf A  26 YSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMHGLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKVIAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLKNEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGNLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALLLGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQDKMTLLRTLWGT 371
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365      


Chain B from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.....ee.....ee..eeee.................hhhhhhhhhhhh...eeeeeehhhhhh............hhhhh..hhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhhhhhhhhh....eeeee..................hhhhhhhhhhhhhhhhh...eeee....................hhhhhh.........eee..eee......hhhhh......hhhhhhhhhhhhhh......eeeee......hhhhhhhhhhhhhhhhhh....eee.....................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuf B  26 YSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMHGLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKVIAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLKNEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGNLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALLLGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQDKMTLLRTLWGT 371
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365      


Chain C from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.....ee.....ee..eeee.................hhhhhhhhhhhh...eeeeeehhhhhh............hhhhh..hhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhhhhhhhhh....eeeee..................hhhhhhhhhhhhhhhhh...eeee....................hhhhhh.........eee..eee......hhhhh......hhhhhhhhhhhhhh......eeeee.......hhhhhhhhhhhhhhhhh....eee.....................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuf C  26 YSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMHGLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKVIAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLKNEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGNLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALLLGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQDKMTLLRTLWGT 371
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365      


Chain D from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.....ee.....ee..eeee.................hhhhhhhhhhh....eeeeeehhhhhh............hhhhh..hhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhhhhhhhh.....eeeee..................hhhhhhhhhhhhhhh.....eeee....................hhhhhh.........eee..eee......hhhhh......hhhhhhhhhhhhhh......eeeee.......hhhhhhhhhhhhhhhhh....eee.....................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuf D  26 YSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMHGLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKVIAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLKNEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGNLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALLLGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQDKMTLLRTLWGT 371
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TUF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TUF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TUF)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2HP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:278 - Pro A:279   [ RasMol ]  
    Phe B:278 - Pro B:279   [ RasMol ]  
    Phe C:278 - Pro C:279   [ RasMol ]  
    Phe D:278 - Pro D:279   [ RasMol ]  
    Trp A:337 - Ser A:338   [ RasMol ]  
    Trp B:337 - Ser B:338   [ RasMol ]  
    Trp C:337 - Ser C:338   [ RasMol ]  
    Trp D:337 - Ser D:338   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tuf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GUNA_XANCP | P19487
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GUNA_XANCP | P19487
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4TUF)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TUF)