Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ATAD2A BROMODOMAIN COMPLEXED WITH 3-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-5-[(PHENYLSULFONYL)AMINO]BENZOICACID
 
Authors :  G. Poncet-Montange, Y. Zhan, J. Bardenhagen, A. Petrocchi, E. Leo, X. S P. Leonard, M. Geck Do, M. Cardozo, W. Palmer, J. Andersen, P. Jones, J
Date :  23 Jun 14  (Deposition) - 24 Dec 14  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.73
Chains :  Asym./Biol. Unit :  A
Keywords :  Atad2A - Bromodomain- Inhibitor Complex, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Poncet-Montange, Y. Zhan, J. P. Bardenhagen, A. Petrocchi, E. Leo, X. Shi, G. R. Lee, P. G. Leonard, M. K. Geck Do, M. G. Cardozo, J. N. Andersen, W. S. Palmer, P. Jones, J. E. Ladbury
Observed Bromodomain Flexibility Reveals Histone Peptide- And Small Molecule Ligand-Compatible Forms Of Atad2.
Biochem. J. V. 466 337 2015
PubMed-ID: 25486442  |  Reference-DOI: 10.1042/BJ20140933

(-) Compounds

Molecule 1 - ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
    ChainsA
    EC Number3.6.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNIC28-BSA4
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentBROMODOMAIN (UNP RESIDUES 981-1108)
    GeneATAD2, L16, PRO2000
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAAA NUCLEAR COREGULATOR CANCER-ASSOCIATED PROTEIN,ANCCA

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 6)

Asymmetric/Biological Unit (5, 6)
No.NameCountTypeFull Name
137N1Ligand/Ion3-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-5-[(PHENYLSULFONYL)AMINO]BENZOIC ACID
2CL1Ligand/IonCHLORIDE ION
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4GOL2Ligand/IonGLYCEROL
5SO41Ligand/IonSULFATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:987 , ARG A:990 , ARG A:994 , ARG A:1067 , ARG A:1072 , HOH A:1342binding site for residue SO4 A 1201
2AC2SOFTWAREGLU A:988 , GLU A:1092 , LEU A:1093 , ASP A:1094 , HOH A:1315 , HOH A:1332binding site for residue GOL A 1202
3AC3SOFTWAREARG A:1082 , ASP A:1083 , HOH A:1385binding site for residue GOL A 1203
4AC4SOFTWAREARG A:1007 , VAL A:1008 , VAL A:1013 , ASP A:1014 , GLU A:1017 , ASN A:1064 , ILE A:1074 , HOH A:1366 , HOH A:1376binding site for residue 37N A 1204
5AC5SOFTWAREARG A:1077 , HOH A:1325 , HOH A:1344binding site for residue CL A 1205
6AC6SOFTWAREVAL A:1046 , LYS A:1047 , HOH A:1419 , HOH A:1445binding site for residue DMS A 1206

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TU4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TU4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TU4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TU4)

(-) Exons   (0, 0)

(no "Exon" information available for 4TU4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:130
                                                                                                                                                                   
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tu4 A  979 SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR 1108
                                   988       998      1008      1018      1028      1038      1048      1058      1068      1078      1088      1098      1108

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TU4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TU4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TU4)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    37N  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tu4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tu4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ATAD2_HUMAN | Q6PL18
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ATAD2_HUMAN | Q6PL18
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ATAD2_HUMAN | Q6PL183dai 4qsp 4qsq 4qsr 4qss 4qst 4qsu 4qsv 4qsw 4qsx 4qut 4quu 4tt2 4tt4 4tt6 4tte 4tu6 4tyl 4tz2 4tz8 5a5n 5a5o 5a5p 5a5q 5a5r 5a81 5a82 5a83 5epb 5f36 5f3a 5lj0

(-) Related Entries Specified in the PDB File

4tt2 4tt4 4tt6 4tte 4tu6