Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  RECOMBINANT BOVINE SKELETAL CALSEQUESTRIN, HIGH-CA2+ FORM
 
Authors :  K. M. Lewis, S. Byrd, C. Kang
Date :  27 Jun 16  (Deposition) - 05 Oct 16  (Release) - 05 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.14
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Calsequestrin, Polymer, Calcium, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. M. Lewis, G. R. Munske, S. S. Byrd, J. Kang, H. J. Cho, E. Rios, C. Kang
Characterization Of Post-Translational Modifications To Calsequestrins Of Cardiac And Skeletal Muscle.
Int J Mol Sci V. 17 2016
PubMed-ID: 27649144  |  Reference-DOI: 10.3390/IJMS17091539
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALSEQUESTRIN
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 35-395
    GeneCASQ1, CASQ1
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (2x)A  
Biological Unit 2 (1x) BC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 45)

Asymmetric Unit (3, 45)
No.NameCountTypeFull Name
1CA40Ligand/IonCALCIUM ION
2CL1Ligand/IonCHLORIDE ION
3MPD4Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CL-1Ligand/IonCHLORIDE ION
3MPD4Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CL-1Ligand/IonCHLORIDE ION
3MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL

(-) Sites  (43, 43)

Asymmetric Unit (43, 43)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:13 , VAL A:15 , GLU A:55 , GLU A:59 , HOH A:654binding site for residue CA A 401
02AC2SOFTWAREGLU A:91 , GLU A:105 , ASP A:107 , GLU A:240 , HOH A:559 , HOH A:606binding site for residue CA A 402
03AC3SOFTWAREGLU A:91 , ASP A:107 , GLU A:243 , HOH A:530 , HOH A:600 , HOH A:675binding site for residue CA A 403
04AC4SOFTWAREASP A:113 , HOH A:551 , HOH A:579 , HOH A:608 , HOH A:686 , HOH A:696binding site for residue CA A 404
05AC5SOFTWAREGLU A:117 , ASP A:290 , HOH A:604 , HOH A:673binding site for residue CA A 405
06AC6SOFTWAREASP A:121 , ASP A:290 , HOH A:549binding site for residue CA A 406
07AC7SOFTWAREGLU A:128 , ASP A:259 , ASP A:261 , HOH A:525 , HOH A:628binding site for residue CA A 407
08AC8SOFTWAREGLU A:135 , ASP A:261 , GLU A:331 , HOH A:501 , HOH A:521 , HOH A:594binding site for residue CA A 408
09AC9SOFTWAREGLU A:135 , ASP A:261 , GLU A:264 , GLU A:331 , HOH A:508 , HOH A:585 , HOH A:630binding site for residue CA A 409
10AD1SOFTWARETHR A:189 , HOH A:514 , HOH A:573 , HOH A:610 , HOH A:634 , HOH A:672binding site for residue CA A 410
11AD2SOFTWAREGLU A:199 , THR A:229 , THR A:277 , HOH A:671 , HOH A:681binding site for residue CA A 411
12AD3SOFTWAREASP A:210 , PRO A:212 , GLU A:217 , HOH A:669binding site for residue CA A 412
13AD4SOFTWAREGLU A:102 , HOH A:582binding site for residue CA A 413
14AD5SOFTWARELEU A:4 , TYR A:239 , TYR A:298 , TRP A:299binding site for residue MPD A 414
15AD6SOFTWAREASP B:13 , VAL B:15 , GLU B:55 , GLU B:59 , HOH B:588 , HOH B:593binding site for residue CA B 401
16AD7SOFTWARELYS A:85 , HOH A:510 , GLU B:91 , GLU B:105 , ASP B:107 , GLU B:240 , HOH B:523binding site for residue CA B 402
17AD8SOFTWAREGLU B:91 , ASP B:107 , GLU B:243 , HOH B:514 , HOH B:577 , HOH B:595binding site for residue CA B 403
18AD9SOFTWAREGLU B:117 , ASP C:290binding site for residue CA B 404
19AE1SOFTWAREASP B:121 , ASP C:290binding site for residue CA B 405
20AE2SOFTWARETHR B:189 , HOH B:532 , HOH B:548 , HOH B:587binding site for residue CA B 406
21AE3SOFTWAREGLU B:199 , THR B:229 , THR B:277 , HOH B:581binding site for residue CA B 407
22AE4SOFTWAREASP B:210 , PRO B:212 , GLU B:217binding site for residue CA B 408
23AE5SOFTWAREASP B:245 , ASP B:247 , ILE B:249 , CL B:416 , HOH B:567binding site for residue CA B 409
24AE6SOFTWAREASP B:113 , HOH B:597 , HOH C:513 , HOH C:538 , HOH C:562 , HOH C:576binding site for residue CA B 410
25AE7SOFTWAREASP B:290 , ASP C:121 , HOH C:564 , HOH C:606binding site for residue CA B 411
26AE8SOFTWAREASP B:259 , ASP B:261 , HOH B:508 , HOH B:546 , GLU C:128 , HOH C:508binding site for residue CA B 412
27AE9SOFTWAREASP B:261 , GLU B:331 , HOH B:509 , GLU C:135 , HOH C:516 , HOH C:528binding site for residue CA B 413
28AF1SOFTWAREGLU B:264 , GLU B:331 , HOH B:524 , GLU C:135 , HOH C:587binding site for residue CA B 414
29AF2SOFTWAREGLU B:102 , GLU B:169binding site for residue CA B 415
30AF3SOFTWARECA B:409 , HOH B:567 , HOH B:592binding site for residue CL B 416
31AF4SOFTWARELEU B:4 , TRP C:242 , TRP C:299binding site for residue MPD B 417
32AF5SOFTWAREHOH B:552 , HOH B:561 , HOH B:570 , ASP C:113 , HOH C:576 , HOH C:629binding site for residue CA C 401
33AF6SOFTWAREGLU B:128 , HOH B:517 , ASP C:259 , ASP C:261 , GLU C:330 , HOH C:604binding site for residue CA C 402
34AF7SOFTWAREGLU B:135 , HOH B:516 , HOH B:547 , ASP C:261 , GLU C:331binding site for residue CA C 403
35AF8SOFTWAREGLU B:135 , HOH B:586 , ASP C:261 , GLU C:264 , GLU C:331 , HOH C:506binding site for residue CA C 404
36AF9SOFTWAREASP C:13 , VAL C:15 , GLU C:55 , GLU C:59 , HOH C:627binding site for residue CA C 405
37AG1SOFTWAREGLU C:91 , GLU C:105 , ASP C:107 , GLU C:240 , HOH C:505 , HOH C:521binding site for residue CA C 406
38AG2SOFTWAREGLU C:91 , ASP C:107 , GLU C:243 , HOH C:520 , HOH C:621binding site for residue CA C 407
39AG3SOFTWAREASP B:290 , GLU C:117binding site for residue CA C 408
40AG4SOFTWARETHR C:189 , HOH C:504 , HOH C:533 , HOH C:561 , HOH C:596 , HOH C:603binding site for residue CA C 409
41AG5SOFTWAREGLU C:199 , THR C:229 , THR C:277 , HOH C:600 , HOH C:617binding site for residue CA C 410
42AG6SOFTWAREASP C:210 , PRO C:212 , GLU C:217 , HOH C:558binding site for residue CA C 411
43AG7SOFTWAREGLU C:102 , GLU C:169binding site for residue CA C 412

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KN1)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1His A:171 -Pro A:172
2Lys A:211 -Pro A:212
3His B:171 -Pro B:172
4Lys B:211 -Pro B:212
5His C:171 -Pro C:172
6Lys C:211 -Pro C:212

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KN1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KN1)

(-) Exons   (0, 0)

(no "Exon" information available for 5KN1)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhh......eeeee..eeeee....hhhhhhhhhhhhhh..eee.hhhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhhh....eeee.hhhhhhhhh.....eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhhhh......eeeeee....eeee..........hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kn1 A   4 LDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEG 349
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343      

Chain B from PDB  Type:PROTEIN  Length:348
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhh......eeeee..eeeee....hhhhhhhhhhhhhh..eeeehhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhh....eeee.hhhhhhhhh.....eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5kn1 B   4 LDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEI 351
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343        

Chain C from PDB  Type:PROTEIN  Length:348
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhh......eeeee..eeeee....hhhhhhhhhhhhhh..eee..hhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhh....eeee.hhhhhhhhh.....eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5kn1 C   4 LDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEI 351
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KN1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KN1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KN1)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:171 - Pro A:172   [ RasMol ]  
    His B:171 - Pro B:172   [ RasMol ]  
    His C:171 - Pro C:172   [ RasMol ]  
    Lys A:211 - Pro A:212   [ RasMol ]  
    Lys B:211 - Pro B:212   [ RasMol ]  
    Lys C:211 - Pro C:212   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kn1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q05JF3_BOVIN | Q05JF3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q05JF3_BOVIN | Q05JF3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q05JF3_BOVIN | Q05JF35kn0 5kn2 5kn3

(-) Related Entries Specified in the PDB File

5kn0 5kn2 5kn3