Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  NATIVE BOVINE SKELETAL CALSEQUESTRIN, LOW-CA2+ FORM
 
Authors :  K. M. Lewis, S. Byrd, C. Kang
Date :  27 Jun 16  (Deposition) - 05 Oct 16  (Release) - 05 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.73
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Calsequestrin, Polymer, Calcium, Glycosylation, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. M. Lewis, G. R. Munske, S. S. Byrd, J. Kang, H. J. Cho, E. Rios, C. Kang
Characterization Of Post-Translational Modifications To Calsequestrins Of Cardiac And Skeletal Muscle.
Int J Mol Sci V. 17 2016
PubMed-ID: 27649144  |  Reference-DOI: 10.3390/IJMS17091539

(-) Compounds

Molecule 1 - CALSEQUESTRIN
    ChainsA, B, C, D
    FragmentUNP RESIDUES 35-395
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 36)

Asymmetric Unit (4, 36)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CA19Ligand/IonCALCIUM ION
3MPD10Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
4NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (2, 8)
No.NameCountTypeFull Name
1BMA-1Ligand/IonBETA-D-MANNOSE
2CA-1Ligand/IonCALCIUM ION
3MPD5Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (3, 9)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CA-1Ligand/IonCALCIUM ION
3MPD5Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
4NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (33, 33)

Asymmetric Unit (33, 33)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:17 , VAL A:18 , MET A:74 , ASP A:80binding site for residue CA A 502
02AC2SOFTWAREGLU A:199 , THR A:229 , THR A:277binding site for residue CA A 503
03AC3SOFTWAREASP A:210 , PRO A:212 , GLU A:217binding site for residue CA A 504
04AC4SOFTWARETHR A:189 , GLU A:194 , THR A:207 , HOH A:601binding site for residue CA A 505
05AC5SOFTWAREPRO A:172binding site for residue CA A 506
06AC6SOFTWARETRP A:242 , TYR A:298 , TRP A:299 , LEU B:4 , ASP B:5 , PHE B:6binding site for residue MPD A 507
07AC7SOFTWAREASP A:321 , NAG A:501binding site for residue MPD A 508
08AC8SOFTWAREASN B:17 , VAL B:18 , MET B:74 , ASP B:76 , ASP B:80binding site for residue CA B 503
09AC9SOFTWAREGLU B:199 , THR B:229 , THR B:277binding site for residue CA B 504
10AD1SOFTWAREASP B:210 , PRO B:212 , GLU B:217binding site for residue CA B 505
11AD2SOFTWARETHR B:189binding site for residue CA B 506
12AD3SOFTWAREPRO B:172binding site for residue CA B 507
13AD4SOFTWARELEU B:294 , LEU B:295binding site for residue MPD B 508
14AD5SOFTWARELEU A:295 , PRO B:7 , GLU B:8binding site for residue MPD B 509
15AD6SOFTWAREASP A:5 , PHE A:6 , TRP B:242 , TYR B:298 , TRP B:299binding site for residue MPD B 510
16AD7SOFTWAREASN C:17 , VAL C:18 , MET C:74 , ASP C:80binding site for residue CA C 502
17AD8SOFTWAREGLU C:199 , THR C:229 , THR C:277binding site for residue CA C 503
18AD9SOFTWAREASP C:210 , PRO C:212 , GLU C:217binding site for residue CA C 504
19AE1SOFTWARETHR C:189 , HOH C:605binding site for residue CA C 505
20AE2SOFTWAREPRO C:172binding site for residue CA C 506
21AE3SOFTWAREPRO C:7 , GLN C:63 , LEU D:294binding site for residue MPD C 507
22AE4SOFTWARETRP C:242 , TYR C:298 , TRP C:299 , ALA C:320 , PHE D:6binding site for residue MPD C 508
23AE5SOFTWARELEU C:294 , LEU C:295 , PRO D:7 , GLU D:8binding site for residue MPD C 509
24AE6SOFTWAREASN D:17 , VAL D:18 , MET D:74 , VAL D:75 , ASP D:76 , ASP D:80binding site for residue CA D 504
25AE7SOFTWAREGLU D:199 , THR D:229 , THR D:277binding site for residue CA D 505
26AE8SOFTWAREASP D:210 , PRO D:212 , GLU D:217binding site for residue CA D 506
27AE9SOFTWARETHR D:189 , GLU D:194 , HOH D:601 , HOH D:602 , HOH D:608binding site for residue CA D 507
28AF1SOFTWAREPHE C:6 , TRP D:242 , TYR D:298 , TRP D:299binding site for residue MPD D 508
29AF2SOFTWAREASN D:316 , ASP D:321 , SER D:322binding site for residue MPD D 509
30AF3SOFTWAREASN A:316 , ASP A:319 , MPD A:508binding site for Mono-Saccharide NAG A 501 bound to ASN A 316
31AF4SOFTWAREILE B:249 , ASN B:316 , ASP B:319 , HOH B:607binding site for Poly-Saccharide residues NAG B 501 through NAG B 502 bound to ASN B 316
32AF5SOFTWAREASN C:316 , ASP C:319binding site for Mono-Saccharide NAG C 501 bound to ASN C 316
33AF6SOFTWAREASP D:156 , ASP D:247 , ASN D:316 , ASP D:319binding site for Poly-Saccharide residues NAG D 501 through BMA D 503 bound to ASN D 316

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KN0)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1His A:171 -Pro A:172
2Lys A:211 -Pro A:212
3His B:171 -Pro B:172
4Lys B:211 -Pro B:212
5His C:171 -Pro C:172
6Lys C:211 -Pro C:212
7His D:171 -Pro D:172
8Lys D:211 -Pro D:212

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KN0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KN0)

(-) Exons   (0, 0)

(no "Exon" information available for 5KN0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhh.....eeeeee...eee.....hhhhhhhhhhhhhh..eee..hhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhh....eeee.hhhhhhhh......eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhh..hhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kn0 A   3 GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE 348
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342      

Chain B from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhh.....eeeeee..eeee.....hhhhhhhhhhhhhh..eeee.hhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhh.....eeee.hhhhhhhh......eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhh..hhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kn0 B   3 GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE 348
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342      

Chain C from PDB  Type:PROTEIN  Length:345
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhh.....eeeeee..eeee.....hhhhhhhhhhhhhh..eee..hhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhh.....eeee.hhhhhhhh......eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhh..hhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kn0 C   4 LDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE 348
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343     

Chain D from PDB  Type:PROTEIN  Length:346
                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee....hhhhhhhhh.eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhh.....eeeeee..eeee.....hhhhhhhhhhhhhh..eee..hhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhh.....eeee.hhhhhhhhh.....eeee.......ee......hhhhhhhhhhhhh...eee.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhhhh......eeeeee.....eee..........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kn0 D   3 GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE 348
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KN0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KN0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KN0)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:171 - Pro A:172   [ RasMol ]  
    His B:171 - Pro B:172   [ RasMol ]  
    His C:171 - Pro C:172   [ RasMol ]  
    His D:171 - Pro D:172   [ RasMol ]  
    Lys A:211 - Pro A:212   [ RasMol ]  
    Lys B:211 - Pro B:212   [ RasMol ]  
    Lys C:211 - Pro C:212   [ RasMol ]  
    Lys D:211 - Pro D:212   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kn0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q05JF3_BOVIN | Q05JF3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q05JF3_BOVIN | Q05JF3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q05JF3_BOVIN | Q05JF35kn1 5kn2 5kn3

(-) Related Entries Specified in the PDB File

5kn1 5kn2 5kn3