Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BANANA LECTIN H84T MUTANT
 
Authors :  J. L. Meagher, J. A. Stuckey
Date :  09 May 14  (Deposition) - 04 Nov 15  (Release) - 04 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Jacalin-Like Lectin Domain, Lectin, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Swanson, D. M. Boudreaux, L. Salmon, J. Chugh, H. C. Winter, J. L. Meagher, S. Andre, P. V. Murphy, S. Oscarson, R. Roy, S. King, M. H. Kaplan, I. J. Goldstein, E. B. Tarbet, B. L. Hurst, D. F. Smee, C. De La Fuente, H. H. Hoffmann, Y. Xue, C. M. Rice, D. Schols, J. V. Garcia, J. A. Stuckey, H. J. Gabius, H. M. Al-Hashimi, D. M. Markovitz
Engineering A Therapeutic Lectin By Uncoupling Mitogenicity From Antiviral Activity.
Cell V. 163 746 2015
PubMed-ID: 26496612  |  Reference-DOI: 10.1016/J.CELL.2015.09.056

(-) Compounds

Molecule 1 - RIPENING-ASSOCIATED PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Mutation: YES
    Organism Common: BANANA
    Organism Scientific: MUSA ACUMINATA
    Organism Taxid: 4641
    Synonym: LECTIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 13)

Asymmetric/Biological Unit (2, 13)
No.NameCountTypeFull Name
1GOL12Ligand/IonGLYCEROL
2NA1Ligand/IonSODIUM ION

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:71 , TYR A:101 , HOH A:383binding site for residue NA A 201
02AC2SOFTWAREGLY A:34 , ASP A:35 , VAL A:36 , ASP A:38 , GLY A:60 , HOH A:413 , HOH A:415binding site for residue GOL A 202
03AC3SOFTWAREGLY A:14 , GLY A:15 , GLY A:129 , LYS A:130 , PHE A:131 , ASP A:133 , HOH A:301binding site for residue GOL A 203
04AC4SOFTWARETYR A:24 , ARG A:25 , ILE A:26 , TYR A:72 , LEU A:73 , LYS A:120 , ILE A:121 , HOH A:399 , HOH A:400binding site for residue GOL A 204
05AC5SOFTWAREHIS A:63 , GLU A:64 , TYR A:101 , HOH A:337 , HIS B:54 , GLY B:56 , GLY B:57 , SER B:58 , HOH B:322 , HOH B:323binding site for residue GOL A 205
06AC6SOFTWAREVAL A:80 , VAL A:87 , THR A:110 , HOH A:307 , HOH A:312 , HOH A:322 , GLN B:68 , HOH B:320binding site for residue GOL A 206
07AC7SOFTWAREMET A:20 , GLU A:51 , ARG A:53binding site for residue GOL A 207
08AC8SOFTWAREALA A:77 , GLY A:93 , PRO A:103 , HOH A:396 , HOH A:405binding site for residue GOL A 208
09AC9SOFTWAREGLY B:34 , ASP B:35 , VAL B:36 , ASP B:38 , GLY B:60 , HOH B:444 , HOH B:451binding site for residue GOL B 201
10AD1SOFTWAREGLY B:14 , GLY B:15 , GLY B:129 , LYS B:130 , PHE B:131 , ASP B:133 , HOH B:305 , HOH B:313binding site for residue GOL B 202
11AD2SOFTWARESER B:33 , GLY B:34 , THR B:61 , HIS B:63 , PHE B:104 , GLY B:105 , ASN B:106 , HOH B:378binding site for residue GOL B 203
12AD3SOFTWAREGLY B:75 , MET B:76 , GLY B:93 , PHE B:94 , SER B:95 , TYR B:101 , HOH B:438 , HOH B:443binding site for residue GOL B 204
13AD4SOFTWAREARG B:25 , ILE B:26 , TYR B:72 , LEU B:73 , LYS B:120 , ILE B:121 , HOH B:306 , HOH B:425binding site for residue GOL B 205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PIU)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:8 -Ala A:9
2Gly A:102 -Pro A:103
3Gly B:8 -Ala B:9
4Gly B:102 -Pro B:103

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PIU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PIU)

(-) Exons   (0, 0)

(no "Exon" information available for 4PIU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:141
                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....eeeeeee..eeeeeeeee...eeeeeeeeee..eeeeeeee....eeeeee......eeeeeeeeeee..eeeeeeeeeee...eeeee.....eeeeeeeee.eeeeeeeee...eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4piu A   3 GAIKVGAWGGNGGSAFDMGPAYRIISVKIFSGDVVDGVDVTFTYYGKTETRHYGGSGGTPHEIVLQEGEYLVGMAGEVANYTGAVVLGKLGFSTNKKAYGPFGNTGGTPFSLPIAAGKISGFFGRGGKFLDAIGVYLEPLA 143
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142 


Chain B from PDB  Type:PROTEIN  Length:142
                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee....eeeeee...eeeeeeeee...eeeeeeeeee..eeeeeeee....eeeeee......eeeeeeeeeee..eeeeeeeeeee...eeeee.....eeeeeeeee.eeeeeeeee.....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4piu B   1 MNGAIKVGAWGGNGGSAFDMGPAYRIISVKIFSGDVVDGVDVTFTYYGKTETRHYGGSGGTPHEIVLQEGEYLVGMAGEVANYTGAVVLGKLGFSTNKKAYGPFGNTGGTPFSLPIAAGKISGFFGRGGKFLDAIGVYLEPL 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PIU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PIU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PIU)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4PIU)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:102 - Pro A:103   [ RasMol ]  
    Gly A:8 - Ala A:9   [ RasMol ]  
    Gly B:102 - Pro B:103   [ RasMol ]  
    Gly B:8 - Ala B:9   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4piu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O22321_MUSAC | O22321
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O22321_MUSAC | O22321
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        O22321_MUSAC | O22321: 2bmy 2bmz 2bn0 4pif 4pik 4pit 5exg

(-) Related Entries Specified in the PDB File

2bmy 2bmz 2bn0 4pif 4pik 4pit