Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  DOMAIN OF UNKNOWN FUNCTION 1792 (DUF1792) WITH MANGANESE
 
Authors :  H. Zhang, H. Wu
Date :  06 May 14  (Deposition) - 06 Aug 14  (Release) - 14 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.34
Chains :  Asym./Biol. Unit :  A
Keywords :  Domain Of Unknown Function 1792 (Duf1792), Glycosyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Zhang, F. Zhu, T. Yang, L. Ding, M. Zhou, J. Li, S. M. Haslam, A. Dell, H. Erlandsen, H. Wu
The Highly Conserved Domain Of Unknown Function 1792 Has A Distinct Glycosyltransferase Fold.
Nat Commun V. 5 4339 2014
PubMed-ID: 25023666  |  Reference-DOI: 10.1038/NCOMMS5339

(-) Compounds

Molecule 1 - PUTATIVE GLYCOSYLTRANSFERASE (GALT1)
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21-GOLD(DE3)PLYSS AG
    Expression System Taxid: 866768
    Fragment: UNP RESIDUES 1-272
    Gene: GALT1, SPAF_1933
    Organism Scientific: STREPTOCOCCUS PARASANGUINIS
    Organism Taxid: 1114965
    Strain: FW213

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2MN1Ligand/IonMANGANESE (II) ION
3UDP1Ligand/IonURIDINE-5'-DIPHOSPHATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:28 , TYR A:44 , SER A:115 , ARG A:116 , GLY A:148 , SER A:151 , PRO A:172 , SER A:173 , LYS A:174 , ASN A:175 , ALA A:176 , MET A:199 , LEU A:200 , GLY A:201 , LYS A:205 , GLY A:222 , HIS A:223 , HIS A:245 , MN A:302 , ACT A:303 , HOH A:530 , HOH A:531 , HOH A:532 , HOH A:535 , HOH A:540 , HOH A:543 , HOH A:549 , HOH A:553 , HOH A:558 , HOH A:620binding site for residue UDP A 301
2AC2SOFTWAREUDP A:301 , ACT A:303 , HOH A:540 , HOH A:543 , HOH A:546 , HOH A:617binding site for residue MN A 302
3AC3SOFTWAREARG A:116 , UDP A:301 , MN A:302 , ACT A:304 , HOH A:617binding site for residue ACT A 303
4AC4SOFTWAREASP A:120 , LYS A:238 , ACT A:303 , HOH A:656binding site for residue ACT A 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PHR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PHR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PHR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PHR)

(-) Exons   (0, 0)

(no "Exon" information available for 4PHR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh.....hhhhhhhhhhhhh.eeee.hhhhhhhhh.........hhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee.hhhh.........hhhhhhhhhhh.....eeeeeee................eeeeeee...hhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhh...eee..hhhhhhhhhhhh.........................hhhhhhheeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4phr A  -4 SEFELMKRLSEIKVLPILESLKYIKHNHASVVRFGDGEIDLMTGHSIPYQDYNEKLAKRLQQILQTKSDEKLLVCLPDVFSNMDRYNQNARHFWERHFLKYSEFYLNCCDAPFYGSTFISRPYIDLIDKSPSEAYFESLKELWRGKDLLIVEGATSRSGVGNDLFVAASSIKRLVCPSKNAFQYYDEILRLTEKNAKNRLILVMLGPTAKVLVADLTTKGYQAIDLGHIDSEYEWYEMGATYKVKLTNKHTAEFNYDEGIELEFSQEYQEQIVARIG 272
                                     5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PHR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PHR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PHR)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4phr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4phr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  I1ZPA1_STRPA | I1ZPA1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  I1ZPA1_STRPA | I1ZPA1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        I1ZPA1_STRPA | I1ZPA1: 4pfx 4phs 5hea 5hec

(-) Related Entries Specified in the PDB File

4pfx 4phs