Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  DNA DOUBLE-STRAND BREAK REPAIR PATHWAY CHOICE IS DIRECTED BY DISTINCT MRE11 NUCLEASE ACTIVITIES
 
Authors :  A. Shibata, D. Moiani, A. S. Arvai, J. Perry, S. M. Harding, M. Genois, R. S. Rossum-Fikkert, A. Kertokalio, F. Romoli, A. Ismail, E. Ismalaj, E. Petricci, M. J. Neale, R. G. Bristow, J. Masson, C. Wyman, P. A. Jeggo J. A. Tainer
Date :  16 Dec 13  (Deposition) - 15 Jan 14  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Dna Repair Dna Double-Strand Break Repair Thermophilic Mre11 Nuclease, Dna Repair Dna Double-Strand Break Repair, Dna Binding Protein-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Shibata, D. Moiani, A. S. Arvai, J. Perry, S. M. Harding, M. M. Genois R. Maity, S. Van Rossum-Fikkert, A. Kertokalio, F. Romoli, A. Ismail E. Ismalaj, E. Petricci, M. J. Neale, R. G. Bristow, J. Y. Masson, C. Wyman, P. A. Jeggo, J. A. Tainer
Dna Double-Strand Break Repair Pathway Choice Is Directed B Distinct Mre11 Nuclease Activities.
Mol. Cell V. 53 7 2014
PubMed-ID: 24316220  |  Reference-DOI: 10.1016/J.MOLCEL.2013.11.003

(-) Compounds

Molecule 1 - EXONUCLEASE, PUTATIVE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTM_1635
    Organism ScientificTHERMOTOGA MARITIMA
    Organism Taxid243274
    StrainATCC 43589 / MSB8 / DSM 3109 / JCM 10099

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
12Q02Ligand/Ion5-(4-HYDROXYBENZYL)-3-(2-METHYLPROPYL)-2-THIOXO-2,3-DIHYDRO-4H-1LAMBDA~4~,3-THIAZOL-4-ONE
2MN4Ligand/IonMANGANESE (II) ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:64 , PRO A:66 , LEU A:71 , LEU A:75 , TRP A:96 , LEU A:99 , PHE A:115 , PHE B:102BINDING SITE FOR RESIDUE 2Q0 A 401
2AC2SOFTWAREPHE A:102 , ARG B:63 , ASN B:64 , PRO B:66 , LEU B:71 , LEU B:74 , HIS B:94 , LEU B:99 , PHE B:115BINDING SITE FOR RESIDUE 2Q0 B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4O24)

(-) Cis Peptide Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1Glu A:142 -Ser A:143
2Ala A:145 -Leu A:146
3Lys A:148 -Asn A:149
4Ala A:187 -Gly A:188
5Tyr A:189 -Ala A:190
6Ile A:192 -Glu A:193
7Glu A:193 -Gln A:194
8Gln A:194 -Gly A:195
9Gln A:226 -Pro A:227
10Glu B:142 -Ser B:143
11Tyr B:189 -Ala B:190
12Ile B:192 -Glu B:193
13Glu B:193 -Gln B:194
14Gln B:194 -Gly B:195
15Gly B:195 -Arg B:196
16Gln B:226 -Pro B:227

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4O24)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4O24)

(-) Exons   (0, 0)

(no "Exon" information available for 4O24)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:331
                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeeeee......ee......eehhhhhhhhhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhhhhhhhh.eee.......hhhhhhhhhhhhhh..eee......eeee.....eeeeeee............hhhhhhhhhhhhhhhhhhhh....eeeeee..ee...............eehhhhh.....eeee......eeee....eee.......hhhhh....eeeeeeee.....eeeeee.....eeeeee...hhhhhhhhhhhhhh...eeeeee........hhhhhh..eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o24 A  -6 IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE 324
                                     3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323 

Chain B from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee......ee......eehhhhhhhhhhhhhhhhhhh...eeeee..........hhhhhhhhhhhhhhhhh...eee.......hhhhhhhhhhhhhh..eee......eeee.....eeeeeee............hhhhhhhhhhhhhhhhhhhh....eeeeee..ee...............eehhhhh.....eeee......eeee....eee.......hhhhh....eeeeeeee.....eeeeee.....eeeeeeee.hhhhhhhhhhhhhh...eeeeeeee..............eeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o24 B   4 LKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE 324
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4O24)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4O24)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4O24)

(-) Gene Ontology  (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2Q0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:145 - Leu A:146   [ RasMol ]  
    Ala A:187 - Gly A:188   [ RasMol ]  
    Gln A:194 - Gly A:195   [ RasMol ]  
    Gln A:226 - Pro A:227   [ RasMol ]  
    Gln B:194 - Gly B:195   [ RasMol ]  
    Gln B:226 - Pro B:227   [ RasMol ]  
    Glu A:142 - Ser A:143   [ RasMol ]  
    Glu A:193 - Gln A:194   [ RasMol ]  
    Glu B:142 - Ser B:143   [ RasMol ]  
    Glu B:193 - Gln B:194   [ RasMol ]  
    Gly B:195 - Arg B:196   [ RasMol ]  
    Ile A:192 - Glu A:193   [ RasMol ]  
    Ile B:192 - Glu B:193   [ RasMol ]  
    Lys A:148 - Asn A:149   [ RasMol ]  
    Tyr A:189 - Ala A:190   [ RasMol ]  
    Tyr B:189 - Ala B:190   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4o24
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X1X0_THEMA | Q9X1X0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9X1X0_THEMA | Q9X1X0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9X1X0_THEMA | Q9X1X02q8u 3qf7 3qg5 3thn 3tho 4nzv 4o43 4o4k 4o5g 4w9m

(-) Related Entries Specified in the PDB File

4nzv MRE11
4o43
4o4k
4o5g