4K6B - JenaLib

Title :   ATOMIC STRUCTURE OF BACTERIOPHAGE HS1 TAIL NEEDLE KNOB

Authors :   A. Bhardwaj, G. Cingolani

Date :   15 Apr 13 (Deposition) - 28 Aug 13 (Release) - 28 Aug 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.10

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Jelly-Roll Topology, Viral Protein, Cell Membrane Penetration, Viral Infection (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. C. Leavitt, L. Gogokhia, E. B. Gilcrease, A. Bhardwaj, G. Cingolani S. R. Casjens
The Tip Of The Tail Needle Affects The Rate Of Dna Delivery By Bacteriophage P22.
Plos One V. 8 70936 2013
PubMed-ID: 23951045 | Reference-DOI: 10.1371/JOURNAL.PONE.0070936

Compounds

Molecule 1 - HS1 KNOB DOMAIN
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	UNIDENTIFIED PHAGE
	Organism Taxid	:	38018

Structural Features

Chains, Units

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:181 , LYS A:235 , LYS A:312 , ILE A:314 , HOH A:761 , HOH A:762 , HOH A:763 , PHE C:282 , SER C:283 , VAL C:284 , ASP C:285 , PHE C:289 , LEU C:290	BINDING SITE FOR RESIDUE GLU A 401
2	AC2	SOFTWARE	SER A:266 , ARG A:267 , ASN A:268 , HOH A:632 , SER B:266 , ARG B:267 , ASN B:268 , SER C:266 , ARG C:267 , ASN C:268	BINDING SITE FOR RESIDUE PO4 A 402
3	AC3	SOFTWARE	PHE A:282 , SER A:283 , VAL A:284 , ASP A:285 , PHE A:289 , LEU A:290 , GLU B:181 , LYS B:235 , LYS B:312 , ILE B:314 , HOH B:750 , HOH B:751 , HOH B:752	BINDING SITE FOR RESIDUE GLU B 401
4	AC4	SOFTWARE	PHE B:282 , SER B:283 , ASP B:285 , PHE B:289 , LEU B:290 , GLU C:181 , LYS C:235 , LYS C:312 , ILE C:314 , HOH C:737 , HOH C:738 , HOH C:739	BINDING SITE FOR RESIDUE GLU C 401

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:155
                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh...eeeeeeeeeeeee....eehhhhhh............ee....ee........eeeeeeeeee.......eeeeeee.....eeeeeee........eeeeeee.....hhhhhhh..eeeeee...eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4k6b A 164 GSSRISALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGAAFTATTIKIIAEQE 401
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313   ||
                                                                                                                                                                                   317|
                                                                                                                                                                                    401

Chain B from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh...eeeeeeeeeeeee....eehhhhhh............ee....ee........eeeeeeeeee.......eeeeeee.....eeeeeee........eeeeeee.....hhhhhhh..eeeeee...eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4k6b B 162 EFGSSRISALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGAAFTATTIKIIAEQE 401
                                   171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     ||
                                                                                                                                                                                     317|
                                                                                                                                                                                      401

Chain C from PDB  Type:PROTEIN  Length:154
                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh...eeeeeeeeeeeee....eehhhhhh............ee....ee........eeeeeeeeee.......eeeeeee.....eeeeeee........eeeeeee.....hhhhhhh..eeeeee...eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4k6b C 165 SSRISALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGAAFTATTIKIIAEQE 401
                                   174       184       194       204       214       224       234       244       254       264       274       284       294       304       314  ||
                                                                                                                                                                                  317|
                                                                                                                                                                                   401

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GLU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:213 - Pro A:214	[ RasMol ]
		Ala B:213 - Pro B:214	[ RasMol ]
		Ala C:213 - Pro C:214	[ RasMol ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4k6b
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

Description