Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HUMAN PROCASPASE-3, CRYSTAL FORM 2
 
Authors :  N. D. Thomsen, J. A. Wells
Date :  20 Mar 13  (Deposition) - 08 May 13  (Release) - 05 Jun 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.89
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Protease, Proenzyme, Caspase, Apoptosis, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. D. Thomsen, J. T. Koerber, J. A. Wells
Structural Snapshots Reveal Distinct Mechanisms Of Procaspase-3 And -7 Activation.
Proc. Natl. Acad. Sci. Usa V. 110 8477 2013
PubMed-ID: 23650375  |  Reference-DOI: 10.1073/PNAS.1306759110

(-) Compounds

Molecule 1 - PROCASPASE-3
    ChainsA, B
    EC Number3.4.22.56
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidADDGENE PLASMID 29653
    Expression System StrainBL21(DE3) PLYSS
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentPROTEASE DOMAIN (UNP RESIDUES 34-277)
    GeneCASP3, CPP32
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCASP-3, APOPAIN, CYSTEINE PROTEASE CPP32, CPP-32, PROTEIN YAMA, SREBP CLEAVAGE ACTIVITY 1, SCA-1, CASPASE-3

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4JQZ)

(-) Sites  (0, 0)

(no "Site" information available for 4JQZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4JQZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4JQZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4JQZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4JQZ)

(-) Exons   (0, 0)

(no "Exon" information available for 4JQZ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:197
                                                                                                                                                                                                                                     
               SCOP domains d4jqza_ A: Apopain (caspase-3, cpp32)                                                                                                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeeeeee....hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhhhhh.eeeeeeeeeee.............hhhhhhhhhh...........eeeeeeee........eeeeee.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..eeee.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4jqz A  33 ADNSYKMDYPEMGLCIIINNKNSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQAARKIPVEADFLYAYSTAPRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESIPCIVSMLTKELYFYH 277
                                    42        52 ||     72        82        92       102       112       122       132       142       152       162 ||    193       208       218       228       238       248||     270       
                                                54|                                                                                                164|            201|                                       249|               
                                                 65                                                                                                 186             207                                        262               

Chain B from PDB  Type:PROTEIN  Length:182
                                                                                                                                                                                                                      
               SCOP domains d4jqzb_ B: Apopain (caspase-3, cpp32)                                                                                                                                                  SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeeee....hhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhh......eeeeeee.........hhhhhhhhhh...hhhhh...eeeeee.........eeeeee..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh...eeee.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4jqz B  33 ADNSYKMDYPEMGLCIIINNKNTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQAHKIPVEADFLYAYSTGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESQIPCIVSMLTKELYFYH 277
                                    42        52 ||     74        84        94       104       114     ||130       140       150       160 ||    192      |214       224       234       244    || 265       275  
                                                54|                                                  120|                                162|           199|                                  249|                
                                                 67                                                   127                                 185            212                                   261                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4JQZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4JQZ)

(-) Gene Ontology  (78, 78)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4jqz)
 
  Sites
(no "Sites" information available for 4jqz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4jqz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4jqz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CASP3_HUMAN | P42574
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.56
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CASP3_HUMAN | P42574
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CASP3_HUMAN | P425741cp3 1gfw 1i3o 1nme 1nmq 1nms 1pau 1qx3 1re1 1rhj 1rhk 1rhm 1rhq 1rhr 1rhu 2c1e 2c2k 2c2m 2c2o 2cdr 2cjx 2cjy 2cnk 2cnl 2cnn 2cno 2dko 2h5i 2h5j 2h65 2j30 2j31 2j32 2j33 2xyg 2xyh 2xyp 2xzd 2xzt 2y0b 3deh 3dei 3dej 3dek 3edq 3gjq 3gjr 3gjs 3gjt 3h0e 3itn 3kjf 3pcx 3pd0 3pd1 4dcj 4dco 4dcp 4eha 4ehd 4ehf 4ehh 4ehk 4ehl 4ehn 4jje 4jqy 4jr0 4pry 4ps0 4qtx 4qty 4qu0 4qu5 4qu8 4qu9 4qua 4qub 4qud 4que 4qug 4quh 4qui 4quj 4qul 5i9b 5i9t 5iab 5iae 5iag 5iaj 5iak 5ian 5iar 5ias 5ibc 5ibp 5ibr 5ic4

(-) Related Entries Specified in the PDB File

4jqy 4jr0 4jr1 4jr2