Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LUXF FROM PHOTOBACTERIUM LEIOGNATHI
 
Authors :  A. Winkler, P. Macheroux, K. Gruber
Date :  05 Feb 13  (Deposition) - 05 Feb 14  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Incomplete Beta-Barrel, Modified 7-Stranded Barrel, Myr-Fmn Binding, Myr-Fmn, Luminescent Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Bergner, A. Winkler, C. Tabib, S. Stipsits, H. Kayer, J. Lee, S. Mayhew, F. Mueller, K. Gruber, P. Macheroux
Shedding Light On Photobacterial Bioluminescence: Structure Biochemical Properties And Utility Of Recombinant Luxf From Photobacterium Leiognathi
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - NON-FLUORESCENT FLAVOPROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneLUXF
    Organism ScientificPHOTOBACTERIUM LEIOGNATHI
    Organism Taxid553611
    SynonymNFP, FP390

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4J2P)

(-) Sites  (0, 0)

(no "Site" information available for 4J2P)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4J2P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4J2P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4J2P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4J2P)

(-) Exons   (0, 0)

(no "Exon" information available for 4J2P)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains d4j2pa_ A: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee........hhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhh......eeee..eeeee..hhhhhhhhhhh...eee....hhhhhhhhhhhhhhhhhhh........eeeeeeeee..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.eeehhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4j2p A   1 MTKWNYGVFFLNFYHVGQQEPSLTMSNALETLRIIDEDTSIYDVVAFSEHHIDKSETKLAPFVSLGKQIHILATSPETVVKAAKYGMPLLFKWDDSQQKRIELLNHYQAAAAKFNVDIAGVRHRLMLFVNVNDNPTQAKAELSIYLEDYLSYTQAETSIDEIINSNAAGNFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHNLN 228
                                    10        20        30        40        50    ||  63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223     
                                                                                 55|                                                                                                                                                                         
                                                                                  59                                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4J2P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4J2P)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4j2p)
 
  Sites
(no "Sites" information available for 4j2p)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4j2p)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4j2p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LUXF_PHOLE | P09142
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LUXF_PHOLE | P09142
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LUXF_PHOLE | P091421nfp

(-) Related Entries Specified in the PDB File

1nfp MYR-FMN-FORM OF THE SAME PROTEIN