4IVF - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF GLUTATHIONE TRANSFERASE HOMOLOG FROM LODDEROMYCES ELONGISPORUS, TARGET EFI-501753, WITH TWO GSH PER SUBUNIT

Authors :   M. W. Vetting, R. Toro, R. Bhosle, N. F. Al Obaidi, L. L. Morisco, S. R. Wa S. Sojitra, E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. B. Hillerich, J. Love, R. D. Seidel, H. J. Imker, R. N. Armstrong, J. A. G S. C. Almo, Enzyme Function Initiative (Efi)

Date :   22 Jan 13 (Deposition) - 13 Feb 13 (Release) - 13 Feb 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,F  (1x)
Biol. Unit 2: B,G  (1x)
Biol. Unit 3: C,D  (1x)
Biol. Unit 4: E,H  (1x)

Keywords :   Gst, Glutathione S-Transferase, Enzyme Function Initiative, Efi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. W. Vetting, R. Toro, R. Bhosle, N. F. Al Obaidi, L. L. Morisco, S. R. Wasserman, S. Sojitra, E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, B. Hillerich, J. Love, R. D. Seidel, H. J. Imker, R. N. Armstrong, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative (Efi)
Crystal Structure Of Glutathione Transferase Homolog From Lodderomyces Elongisporus, Target Efi-501753, With Two Gsh Per Subunit
To Be Published
PubMed: search

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
	Chains	:	A, B, C, D, E, F, G, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	LELG_04376
	Organism Common	:	YEAST
	Organism Scientific	:	LODDEROMYCES ELONGISPORUS
	Organism Taxid	:	379508
	Strain	:	NRRL YB-4239

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A					F
Biological Unit 2 (1x)	:		B					G
Biological Unit 3 (1x)	:			C	D
Biological Unit 4 (1x)	:					E			H

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 17)

No.	Name	Count	Type	Full Name
1	CIT	1	Ligand/Ion	CITRIC ACID
2	GSH	16	Ligand/Ion	GLUTATHIONE

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	CIT	-1	Ligand/Ion	CITRIC ACID
2	GSH	4	Ligand/Ion	GLUTATHIONE

Biological Unit 2 (1, 4)

No.	Name	Count	Type	Full Name
1	CIT	-1	Ligand/Ion	CITRIC ACID
2	GSH	4	Ligand/Ion	GLUTATHIONE

Biological Unit 3 (1, 4)

No.	Name	Count	Type	Full Name
1	CIT	-1	Ligand/Ion	CITRIC ACID
2	GSH	4	Ligand/Ion	GLUTATHIONE

Biological Unit 4 (2, 5)

No.	Name	Count	Type	Full Name
1	CIT	1	Ligand/Ion	CITRIC ACID
2	GSH	4	Ligand/Ion	GLUTATHIONE

Asymmetric Unit (17, 17)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASN A:17 , ARG A:57 , GLY A:119 , PRO A:120 , GLY A:123 , TRP A:184 , GSH A:302 , HOH A:412 , HOH A:423 , HOH A:424 , HOH A:449 , HOH A:529 , ARG F:142 , HOH F:478	BINDING SITE FOR RESIDUE GSH A 301
02	AC2	SOFTWARE	THR A:15 , ASN A:17 , THR A:44 , LYS A:45 , ARG A:57 , ILE A:58 , PRO A:59 , GLN A:77 , THR A:78 , GSH A:301 , HOH A:411 , HOH A:412 , HOH A:415 , HOH A:426 , HOH A:549 , GLU F:117	BINDING SITE FOR RESIDUE GSH A 302
03	AC3	SOFTWARE	ASN B:17 , ARG B:57 , GLY B:119 , PRO B:120 , GLY B:123 , TRP B:184 , GSH B:302 , HOH B:406 , HOH B:411 , HOH B:446 , ARG G:142	BINDING SITE FOR RESIDUE GSH B 301
04	AC4	SOFTWARE	THR B:15 , ASN B:17 , LEU B:39 , THR B:44 , ARG B:57 , ILE B:58 , GLN B:77 , THR B:78 , GSH B:301 , HOH B:404 , HOH B:421 , HOH B:480 , GLU G:117	BINDING SITE FOR RESIDUE GSH B 302
05	AC5	SOFTWARE	ASN C:17 , ARG C:57 , GLY C:119 , PRO C:120 , GLY C:123 , TRP C:184 , GSH C:302 , HOH C:411 , HOH C:414 , HOH C:421 , HOH C:422 , HOH C:524 , ARG D:142 , HOH D:437	BINDING SITE FOR RESIDUE GSH C 301
06	AC6	SOFTWARE	THR C:15 , ASN C:17 , THR C:44 , LYS C:45 , ARG C:57 , ILE C:58 , GLN C:77 , THR C:78 , GSH C:301 , HOH C:402 , HOH C:403 , HOH C:408 , HOH C:421 , GLU D:117	BINDING SITE FOR RESIDUE GSH C 302
07	AC7	SOFTWARE	ARG C:142 , ASN D:17 , ARG D:57 , GLY D:119 , PRO D:120 , GLY D:123 , TRP D:184 , GSH D:302 , HOH D:422 , HOH D:426 , HOH D:434 , HOH D:454 , HOH D:488 , HOH D:507 , HOH D:514	BINDING SITE FOR RESIDUE GSH D 301
08	AC8	SOFTWARE	GLU C:117 , THR D:15 , ASN D:17 , LEU D:39 , LYS D:45 , ARG D:57 , ILE D:58 , GLN D:77 , THR D:78 , GSH D:301 , HOH D:401 , HOH D:413 , HOH D:453	BINDING SITE FOR RESIDUE GSH D 302
09	AC9	SOFTWARE	PRO E:14 , THR E:15 , ASN E:126 , PHE E:130 , ARG E:187 , ARG E:190 , LYS E:223 , GSH E:302 , HOH E:422 , HOH E:451 , HOH E:563 , GLU F:192	BINDING SITE FOR RESIDUE CIT E 301
10	BC1	SOFTWARE	ASN E:17 , ARG E:57 , GLY E:119 , PRO E:120 , GLY E:123 , TRP E:184 , CIT E:301 , GSH E:303 , HOH E:409 , HOH E:414 , HOH E:415 , HOH E:426 , ARG H:142 , HOH H:471	BINDING SITE FOR RESIDUE GSH E 302
11	BC2	SOFTWARE	THR E:15 , ASN E:17 , THR E:44 , LYS E:45 , ARG E:57 , ILE E:58 , GLN E:77 , THR E:78 , GSH E:302 , HOH E:403 , HOH E:405 , HOH E:408 , HOH E:409 , GLU H:117	BINDING SITE FOR RESIDUE GSH E 303
12	BC3	SOFTWARE	ARG A:142 , ASN F:17 , ARG F:57 , GLY F:119 , PRO F:120 , GLY F:123 , HIS F:127 , TRP F:184 , GSH F:302 , HOH F:403 , HOH F:404 , HOH F:413 , HOH F:453	BINDING SITE FOR RESIDUE GSH F 301
13	BC4	SOFTWARE	GLU A:117 , THR F:15 , ASN F:17 , THR F:44 , LYS F:45 , ARG F:57 , ILE F:58 , GLN F:77 , THR F:78 , GSH F:301 , HOH F:407 , HOH F:427 , HOH F:486 , HOH F:535	BINDING SITE FOR RESIDUE GSH F 302
14	BC5	SOFTWARE	ARG B:142 , ASN G:17 , ARG G:57 , GLY G:119 , PRO G:120 , GLY G:123 , TRP G:184 , GSH G:302 , HOH G:414 , HOH G:419 , HOH G:445	BINDING SITE FOR RESIDUE GSH G 301
15	BC6	SOFTWARE	GLU B:117 , THR G:15 , ASN G:17 , LEU G:39 , THR G:44 , LYS G:45 , ARG G:57 , ILE G:58 , PRO G:59 , GLN G:77 , THR G:78 , GSH G:301 , HOH G:404 , HOH G:411 , HOH G:414 , HOH G:425	BINDING SITE FOR RESIDUE GSH G 302
16	BC7	SOFTWARE	ARG E:142 , ASN H:17 , ARG H:57 , GLY H:119 , PRO H:120 , GLY H:123 , TRP H:184 , GSH H:302 , HOH H:415 , HOH H:420 , HOH H:423 , HOH H:431 , HOH H:470	BINDING SITE FOR RESIDUE GSH H 301
17	BC8	SOFTWARE	GLU E:117 , THR H:15 , ASN H:17 , LEU H:39 , THR H:44 , LYS H:45 , ARG H:57 , ILE H:58 , GLN H:77 , THR H:78 , GSH H:301 , HOH H:443 , HOH H:452	BINDING SITE FOR RESIDUE GSH H 302

(no "SS Bond" information available for 4IVF)

Asymmetric Unit

No.	Residues
1	Ile A:58	-	Pro A:59
2	Val A:220	-	Pro A:221
3	Ile B:58	-	Pro B:59
4	Val B:220	-	Pro B:221
5	Ile C:58	-	Pro C:59
6	Val C:220	-	Pro C:221
7	Ile D:58	-	Pro D:59
8	Val D:220	-	Pro D:221
9	Ile E:58	-	Pro E:59
10	Val E:220	-	Pro E:221
11	Ile F:58	-	Pro F:59
12	Val F:220	-	Pro F:221
13	Ile G:58	-	Pro G:59
14	Val G:220	-	Pro G:221
15	Ile H:58	-	Pro H:59
16	Val H:220	-	Pro H:221

(no "SAP(SNP)/Variant" information available for 4IVF)

(no "PROSITE Motif" information available for 4IVF)

(no "Exon" information available for 4IVF)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:221
                                                                                                                                                                                                                                                             
               SCOP domains d4ivfa1 A:5-94 automated matches                                                          ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf A   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNA 225
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Chain B from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains d4ivfb1 B:5-94 automated matches                                                          d4ivfb2 B:95-222 automated matches                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf B   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPP 222
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214

Chain C from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains d4ivfc1 C:5-94 automated matches                                                          d4ivfc2 C:95-230 automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf C   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNAENLYF 230
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Chain D from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains d4ivfd1 D:5-94 automated matches                                                          d4ivfd2 D:95-223 automated matches                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf D   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPK 223
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214

Chain E from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains d4ivfe1 E:5-94 automated matches                                                          d4ivfe2 E:95-230 automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf E   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNAENLYF 230
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Chain F from PDB  Type:PROTEIN  Length:227
                                                                                                                                                                                                                                                                   
               SCOP domains d4ivff1 F:5-94 automated matches                                                          d4ivff2 F:95-231 automated matches                                                                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf F   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNAENLYFQ 231
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Chain G from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains d4ivfg1 G:5-94 automated matches                                                          d4ivfg2 G:95-230 automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeeeeeeee..eeeeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf G   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNAENLYF 230
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Chain H from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains d4ivfh1 H:5-94 automated matches                                                          d4ivfh2 H:95-222 automated matches                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh......eeee.........eeeehhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ivf H   5 LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPP 222
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: automated matches (86)

Protein domain: automated matches (86)

Lodderomyces elongisporus [TaxId: 379508] (1)

1a	d4ivfb2	B:95-222
1b	d4ivfc2	C:95-230
1c	d4ivfd2	D:95-223
1d	d4ivfe2	E:95-230
1e	d4ivff2	F:95-231
1f	d4ivfg2	G:95-230
1g	d4ivfh2	H:95-222

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: automated matches (347)

Protein domain: automated matches (347)

Lodderomyces elongisporus [TaxId: 379508] (1)

2a	d4ivfa1	A:5-94
2b	d4ivfb1	B:5-94
2c	d4ivfc1	C:5-94
2d	d4ivfd1	D:5-94
2e	d4ivfe1	E:5-94
2f	d4ivff1	F:5-94
2g	d4ivfg1	G:5-94
2h	d4ivfh1	H:5-94

(no "CATH Domain" information available for 4IVF)

(no "Pfam Domain" information available for 4IVF)

Asymmetric Unit(hide GO term definitions)

(no "Gene Ontology" information available for 4IVF)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ile A:58 - Pro A:59	[ RasMol ]
		Ile B:58 - Pro B:59	[ RasMol ]
		Ile C:58 - Pro C:59	[ RasMol ]
		Ile D:58 - Pro D:59	[ RasMol ]
		Ile E:58 - Pro E:59	[ RasMol ]
		Ile F:58 - Pro F:59	[ RasMol ]
		Ile G:58 - Pro G:59	[ RasMol ]
		Ile H:58 - Pro H:59	[ RasMol ]
		Val A:220 - Pro A:221	[ RasMol ]
		Val B:220 - Pro B:221	[ RasMol ]
		Val C:220 - Pro C:221	[ RasMol ]
		Val D:220 - Pro D:221	[ RasMol ]
		Val E:220 - Pro E:221	[ RasMol ]
		Val F:220 - Pro F:221	[ RasMol ]
		Val G:220 - Pro G:221	[ RasMol ]
		Val H:220 - Pro H:221	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4ivf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	A5E437_LODEL \| A5E437
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	A5E437_LODEL \| A5E437
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 4IVF)

(no "Related Entries Specified in the PDB File" available for 4IVF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 17)

Sites (17, 17)

SS Bonds (0, 0)

Cis Peptide Bonds (16, 16)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 15)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File