Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE TRUNCATED NECK AND C-TERMINAL MOTOR HOMOLOGY DOMAIN OF VIK1 FROM CANDIDA GLABRATA
 
Authors :  D. Duan, J. S. Allingham
Date :  13 Aug 12  (Deposition) - 03 Oct 12  (Release) - 12 Dec 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.42
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kinesin Motor Domain-Like Fold, Microtubule Binding Protein, Kinesin Associated Protein, Kar3, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Duan, Z. Jia, M. Joshi, J. Brunton, M. Chan, D. Drew, D. Davis, J. S. Allingham
Neck Rotation And Neck Mimic Docking In The Noncatalytic Kar3-Associated Protein Vik1.
J. Biol. Chem. V. 287 40292 2012
PubMed-ID: 23043140  |  Reference-DOI: 10.1074/JBC.M112.416529

(-) Compounds

Molecule 1 - SPINDLE POLE BODY-ASSOCIATED PROTEIN VIK1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: MODIFIED PET16B
    Expression System Strain: BL21 RIL CODON +
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 313-584
    Gene: CAGL0D00638G, CAGL0H00638G
    Organism Common: YEAST
    Organism Scientific: CANDIDA GLABRATA
    Organism Taxid: 284593
    Strain: ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4GKP)

(-) Sites  (0, 0)

(no "Site" information available for 4GKP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GKP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4GKP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GKP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GKP)

(-) Exons   (0, 0)

(no "Exon" information available for 4GKP)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.......eeee....eeee....eeee..eeeee......hhhhhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhh...eeeeeeeeee..ee.....eee....eee....ee.hhh...........eeeeeeeeee........eeeeeeee.hhhhhhhhhhh.hhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gkp A 325 RLFANIIEDEISEKLIVNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENFNLFSVGSSNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSSQDLLSNKLKIEESTISLGSTLITLDEITDKLKKKYSNGIGLSKFQFFCLQDIEPIPIDFYFIEIYQPSIYPILKRSSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLSFIRNPK 582
                                   334       344       354       364       374       384       394       404       414       424      |438   ||  458       468       480   ||  495       505       515       525   ||  543       553       563       573         
                                                                                                                                    431|   442|                     477| 484|                                    529|                                            
                                                                                                                                     436    453                      480  490                                     538                                            


Chain B from PDB  Type:PROTEIN  Length:254
                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeee.......eeee....eeee....eeee..eeeee..........hhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhh...eeeeeeeeee......ee.......eeee....eeee....eehhhhh.........eeeeeeeeee........eeeeeeee.hhhhhhhhhhh........hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gkp B 310 GHMLLNSITELKGCARLFANIIEDEISEKLIVNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENFNLFSVGSSNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSDNADSQDLLSNDVEIKLKIEESTISLGSTLITLDEITYSQLNHQNGIGLSKFQFFCLQDIEPIPIDFYFIEIYQPSIYPILKRSTGTESNLNSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLSF 577
                                   319       329       339       349       359       369       379       389       399       409       419       429       439  ||   455       465       483       493       503       513       523       533       543       553       563       573    
                                                                                                                                                              442|                      474|                                                                                              
                                                                                                                                                               449                       483
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4GKP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GKP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GKP)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4gkp)
 
  Sites
(no "Sites" information available for 4gkp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4gkp)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gkp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6FSG8_CANGA | Q6FSG8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6FSG8_CANGA | Q6FSG8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6FSG8_CANGA | Q6FSG8: 4gkq

(-) Related Entries Specified in the PDB File

4gkq 4gkr