Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FERREDOXIN-NADP REDUCTASE FROM BURKHOLDERIA THAILANDENSIS E264
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  15 May 12  (Deposition) - 30 May 12  (Release) - 30 Oct 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Ssgcid, Nih, Niaid, Sbri, Uw, Emerald Biostructures, Ferredoxin-Nadp Reductase, Structural Genomics, National Institute Of Allergy And Infectious Diseases, Seattle Structural Genomics Center For Infectious Disease, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Baugh, L. A. Gallagher, R. Patrapuvich, M. C. Clifton, A. S. Gardberg, T. E. Edwards, B. Armour, D. W. Begley, S. H. Dieterich, D. M. Dranow, J. Abendroth, J. W. Fairman, D. Fox, B. L. Staker, I. Phan, A. Gillespie, R. Choi, S. Nakazawa-Hewitt, M. T. Nguyen, A. Napuli, L. Barrett, G. W. Buchko, R. Stacy, P. J. Myler, L. J. Stewart, C. Manoil W. C. Van Voorhis
Combining Functional And Structural Genomics To Sample The Essential Burkholderia Structome.
Plos One V. 8 53851 2013
PubMed-ID: 23382856  |  Reference-DOI: 10.1371/JOURNAL.PONE.0053851

(-) Compounds

Molecule 1 - FERREDOXIN--NADP REDUCTASE
    ChainsA, B
    EC Number1.18.1.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidAVA0421
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBTH_I0211
    Organism ScientificBURKHOLDERIA THAILANDENSIS
    Organism Taxid271848
    StrainE264 / ATCC 700388 / DSM 13276 / CIP 106301

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4F7D)

(-) Sites  (0, 0)

(no "Site" information available for 4F7D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4F7D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4F7D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4F7D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4F7D)

(-) Exons   (0, 0)

(no "Exon" information available for 4F7D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:246
                                                                                                                                                                                                                                                                                      
               SCOP domains d4f7da1 A:17-115 automated matches                                                                 d4f7da2 A:116-270 automated matches                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeeeeee....eeeeee............eeeeeeee..eeeeeeee.........eeeeee....hhhhhhhh......eeeee.......hhhhh....eeeeee...hhhhhhhhh.hhhhhhhh.eeeeee...hhhhhhhhhhhhhh.....hhhhhhhhheeeee....hhhhhhh.hhhhhh.........eeeeeeehhhhhhhhhhhhhh.............eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4f7d A  17 SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV 270
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196|      214       224       234       244       254       264      
                                                                                                                                                                                                             196|                                                                 
                                                                                                                                                                                                              205                                                                 

Chain B from PDB  Type:PROTEIN  Length:247
                                                                                                                                                                                                                                                                                       
               SCOP domains d4f7db1 B:16-115 automated matches                                                                  d4f7db2 B:116-271 automated matches                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeee....eeeeeee...........eeeeeeee..eeeeeeee........eeeeeee....hhhhhhhh......eeeee.......hhhhh....eeeeee...hhhhhhhhh.hhhhhhhh.eeeeee...hhhhhhhhhhhhh......hhhhhhhhheeeee...hhhhhhhhhhhhhh.........eeeeeeehhhhhhhhhhhhhhh............eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f7d B  16 MSKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD 271
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195|      214       224       234       244       254       264       
                                                                                                                                                                                                             195|                                                                  
                                                                                                                                                                                                              205                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4F7D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4F7D)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4f7d)
 
  Sites
(no "Sites" information available for 4f7d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4f7d)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4f7d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2T230_BURTA | Q2T230
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.18.1.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q2T230_BURTA | Q2T230
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q2T230_BURTA | Q2T2304fk8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4F7D)