Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  LYTR-CPS2A-PSR FAMILY PROTEIN YWTF (TAGT) WITH BOUND OCTAPRENYL PYROPHOSPHATE LIPID
 
Authors :  A. Eberhardt, C. N. Hoyland, D. Vollmer, S. Bisle, R. M. Cleverley, O. Jo S. Havarstein, R. J. Lewis, W. Vollmer
Date :  20 Jan 12  (Deposition) - 04 Apr 12  (Release) - 20 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.79
Chains :  Asym./Biol. Unit :  A
Keywords :  Possible Role In Wall Techoic Acid Synthesis, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Eberhardt, C. N. Hoyland, D. Vollmer, S. Bisle, R. M. Cleverley, O. Johnsborg, L. S. Havarstein, R. J. Lewis, W. Vollmer
Attachment Of Capsular Polysaccharide To The Cell Wall In Streptococcus Pneumoniae.
Microb Drug Resist V. 18 240 2012
PubMed-ID: 22432711  |  Reference-DOI: 10.1089/MDR.2011.0232

(-) Compounds

Molecule 1 - PUTATIVE TRANSCRIPTIONAL REGULATOR YWTF
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21DE3
    Expression System Taxid562
    Expression System Vector TypePET28A
    FragmentUNP RESIDUES 98-481
    GeneYWTF, BSU35840
    Organism ScientificBACILLUS SUBTILIS
    Organism Taxid1423
    Strain168

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1VTP1Ligand/Ion(2Z,6Z,10Z,14Z,18Z,22E,26E)-3,7,11,15,19,23,27,31-OCTAMETHYLDOTRIACONTA-2,6,10,14,18,22,26,30-OCTAEN-1-YL TRIHYDROGEN DIPHOSPHATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:82 , ASP A:97 , PHE A:104 , ASN A:163 , PHE A:164 , PHE A:167 , VAL A:216 , ARG A:217 , ARG A:227 , GLN A:231 , LEU A:235 , SER A:236 , ILE A:239 , ILE A:278BINDING SITE FOR RESIDUE VTP A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DE9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4DE9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4DE9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4DE9)

(-) Exons   (0, 0)

(no "Exon" information available for 4DE9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:240
 aligned with YWTF_BACSU | Q7WY78 from UniProtKB/Swiss-Prot  Length:322

    Alignment length:272
                                    60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320  
           YWTF_BACSU    51 HVSLARGEQSVKRIKEFDPGKDSFSVLLLGIDAREKNGETVDQARSDANVLVTFNRKEKTAKMLSIPRDAYVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVTVKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTRKADSDLLRGQRQMEVLSAIIDKSKSLSSIPAYDDIVDTMGQNLKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVYYFKLNQQKLQEVKKELQNDLGV 322
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................eeeeeeee.----------...eeeeeeeeee....eeeeee.....eeee...eeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeehhhhhhhhhhh..eeeee.hhhhhhhhhhhh........eeeeehhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhh-----------------.ee..hhhhhhhhhhhhh...eeeee...eeee......eeeehhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4de9 A  51 HVSLARGEQSVKRIKEFDPGKDSFSVLLLGID----------QARSDANVLVTFNRKEKTAKMLSIPRDAYVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVTVKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTR-----LLRGQRQMEVLSAIIDKSKS-----------------LKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVYYFKLNQQKLQEVKKELQNDLGV 322
                                    60        70        80 |       -  |    100       110       120       130       140       150       160       170       180       190       200       210        |-    |  230       240   |     -         - |     270       280       290       300       310       320  
                                                          82         93                                                                                                                           219   225                244               262                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4DE9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DE9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DE9)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (YWTF_BACSU | Q7WY78)
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    VTP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4de9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4de9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YWTF_BACSU | Q7WY78
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  YWTF_BACSU | Q7WY78
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        YWTF_BACSU | Q7WY783mej

(-) Related Entries Specified in the PDB File

4de8