Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF FULL LENGTH HUMAN AMPK IN COMPLEX WITH A SMALL MOLECULE ACTIVATOR, A BENZIMIDAZOLE DERIVATIVE (991)
 
Authors :  B. Xiao, M. J. Sanders, D. Carmena, N. J. Bright, L. F. Haire, E. Underwoo B. R. Patel, R. B. Heath, P. A. Walker, S. Hallen, F. Giordanetto, S. R. M D. Carling, S. J. Gamblin
Date :  14 Nov 13  (Deposition) - 25 Dec 13  (Release) - 12 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.02
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  C,D,F  (1x)
Biol. Unit 2:  A,B,E  (1x)
Keywords :  Transferase, Nucleotide-Binding, Staurosporine-Binding, Serine/Threonine-Protein Kinase, Activator, Carbohydrate Binding Module (Cbm) (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Xiao, M. J. Sanders, D. Carmena, N. J. Bright, L. F. Haire, E. Underwood, B. R. Patel, R. B. Heath, P. A. Walker, S. Hallen, F. Giordanetto, S. R. Martin, D. Carling, S. J. Gamblin
Structural Basis Of Ampk Regulation By Small Molecule Activators.
Nat. Commun. V. 4 3017 2013
PubMed-ID: 24352254  |  Reference-DOI: 10.1038/NCOMMS4017

(-) Compounds

Molecule 1 - 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-2
    ChainsA, C
    EC Number2.7.11.1, 2.7.11.27, 2.7.11.31
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsA 172 THR AND C 172 THR ARE PHOSPHORYLATED.
    SynonymAMPK SUBUNIT ALPHA-2, ACETYL-COA CARBOXYLASE KINASE, ACACA KINASE, HYDROXYMETHYLGLUTARYL-COA REDUCTASE KINASE, HMGCR KINASE
 
Molecule 2 - 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT BETA-1
    ChainsB, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsB 108 SER AND D 108 SER ARE PHOSPHORYLATED.
    SynonymAMPK SUBUNIT BETA-1, AMPKB
 
Molecule 3 - 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
    ChainsE, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAMPK GAMMA1, AMPK SUBUNIT GAMMA-1, AMPKG

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)  CD F
Biological Unit 2 (1x)AB  E 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 14)

Asymmetric Unit (5, 14)
No.NameCountTypeFull Name
19922Ligand/Ion5-[[6-CHLORANYL-5-(1-METHYLINDOL-5-YL)-1H-BENZIMIDAZOL-2-YL]OXY]-2-METHYL-BENZOIC ACID
2AMP6Ligand/IonADENOSINE MONOPHOSPHATE
3SEP2Mod. Amino AcidPHOSPHOSERINE
4STU2Ligand/IonSTAUROSPORINE
5TPO2Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 1 (5, 7)
No.NameCountTypeFull Name
19921Ligand/Ion5-[[6-CHLORANYL-5-(1-METHYLINDOL-5-YL)-1H-BENZIMIDAZOL-2-YL]OXY]-2-METHYL-BENZOIC ACID
2AMP3Ligand/IonADENOSINE MONOPHOSPHATE
3SEP1Mod. Amino AcidPHOSPHOSERINE
4STU1Ligand/IonSTAUROSPORINE
5TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 2 (5, 7)
No.NameCountTypeFull Name
19921Ligand/Ion5-[[6-CHLORANYL-5-(1-METHYLINDOL-5-YL)-1H-BENZIMIDAZOL-2-YL]OXY]-2-METHYL-BENZOIC ACID
2AMP3Ligand/IonADENOSINE MONOPHOSPHATE
3SEP1Mod. Amino AcidPHOSPHOSERINE
4STU1Ligand/IonSTAUROSPORINE
5TPO1Mod. Amino AcidPHOSPHOTHREONINE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREMET E:85 , THR E:87 , THR E:89 , ASP E:90 , TYR E:121 , PRO E:128 , LEU E:129 , VAL E:130 , ILE E:150 , HIS E:151 , ARG E:152BINDING SITE FOR RESIDUE AMP E1326
02AC2SOFTWAREARG E:70 , LYS E:170 , ILE E:240 , SER E:242 , PHE E:244 , ASP E:245 , ARG E:269 , LEU E:277 , VAL E:297 , HIS E:298 , ARG E:299BINDING SITE FOR RESIDUE AMP E1327
03AC3SOFTWAREHIS E:151 , THR E:200 , ILE E:204 , ALA E:205 , VAL E:225 , SER E:226 , ALA E:227 , HIS E:298 , ILE E:312 , SER E:314 , SER E:316 , ASP E:317BINDING SITE FOR RESIDUE AMP E1328
04AC4SOFTWARETHR F:87 , THR F:89 , ASP F:90 , PRO F:128 , VAL F:130 , ILE F:150 , HIS F:151 , ARG F:152 , PRO F:154BINDING SITE FOR RESIDUE AMP F1326
05AC5SOFTWAREARG F:70 , LYS F:170 , ILE F:240 , SER F:242 , ASP F:245 , ARG F:269 , VAL F:276 , LEU F:277 , VAL F:297 , HIS F:298 , ARG F:299BINDING SITE FOR RESIDUE AMP F1327
06AC6SOFTWAREHIS F:151 , THR F:200 , ILE F:204 , ALA F:205 , VAL F:225 , SER F:226 , ALA F:227 , PRO F:229 , HIS F:298 , ILE F:312 , SER F:314 , SER F:316 , ASP F:317BINDING SITE FOR RESIDUE AMP F1328
07AC7SOFTWARELEU A:22 , GLY A:23 , VAL A:24 , GLY A:25 , VAL A:30 , ALA A:43 , GLU A:94 , TYR A:95 , VAL A:96 , GLU A:100 , GLU A:143 , ASN A:144 , LEU A:146 , ASP A:157BINDING SITE FOR RESIDUE STU A1552
08AC8SOFTWARELEU C:22 , GLY C:23 , VAL C:24 , GLY C:25 , VAL C:30 , ALA C:43 , GLU C:94 , TYR C:95 , VAL C:96 , GLU C:100 , GLU C:143 , ASN C:144 , LEU C:146 , ASP C:157BINDING SITE FOR RESIDUE STU C1552
09AC9SOFTWARELEU A:18 , LYS A:29 , LYS A:31 , ILE A:46 , ASN A:48 , ASP A:88 , ARG B:83 , THR B:106 , VAL B:113BINDING SITE FOR RESIDUE 992 A1553
10BC1SOFTWARELEU C:18 , LYS C:29 , LYS C:31 , ILE C:46 , ASN C:48 , ASP C:88 , ARG D:83 , THR D:106 , ARG D:107 , SEP D:108 , VAL D:113BINDING SITE FOR RESIDUE 992 C1553

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CFE)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Val D:193A-Cys D:194A

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 6)

Asymmetric Unit (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033453T89SAAKG1_HUMANPolymorphism1126930E/FT89S
2UniProtVAR_035623P371TAAPK2_HUMANUnclassified  ---A/CP371T
3UniProtVAR_040355R407QAAPK2_HUMANUnclassified  ---A/CR407Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033453T89SAAKG1_HUMANPolymorphism1126930FT89S
2UniProtVAR_035623P371TAAPK2_HUMANUnclassified  ---CP371T
3UniProtVAR_040355R407QAAPK2_HUMANUnclassified  ---CR407Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033453T89SAAKG1_HUMANPolymorphism1126930ET89S
2UniProtVAR_035623P371TAAPK2_HUMANUnclassified  ---AP371T
3UniProtVAR_040355R407QAAPK2_HUMANUnclassified  ---AR407Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 12)

Asymmetric Unit (3, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.AAPK2_HUMAN22-45
 
  2A:22-45
C:22-45
2CBSPS51371 CBS domain profile.AAKG1_HUMAN43-103
 
125-187
 
198-260
 
272-329
 
  8E:43-103
F:43-103
E:128-187
F:128-187
E:198-260
F:198-260
E:272-325
F:276-325
3PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.AAPK2_HUMAN135-147
 
  2A:135-147
C:135-147
Biological Unit 1 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.AAPK2_HUMAN22-45
 
  1-
C:22-45
2CBSPS51371 CBS domain profile.AAKG1_HUMAN43-103
 
125-187
 
198-260
 
272-329
 
  4-
F:43-103
-
F:128-187
-
F:198-260
-
F:276-325
3PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.AAPK2_HUMAN135-147
 
  1-
C:135-147
Biological Unit 2 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.AAPK2_HUMAN22-45
 
  1A:22-45
-
2CBSPS51371 CBS domain profile.AAKG1_HUMAN43-103
 
125-187
 
198-260
 
272-329
 
  4E:43-103
-
E:128-187
-
E:198-260
-
E:272-325
-
3PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.AAPK2_HUMAN135-147
 
  1A:135-147
-

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003712441ENSE00001454737chr1:57110995-57111154160AAPK2_HUMAN1-32322A:8-32
C:10-32
25
23
1.2ENST000003712442ENSE00001064895chr1:57140054-57140195142AAPK2_HUMAN32-79482A:32-79
C:32-79
48
48
1.3ENST000003712443ENSE00001064887chr1:57157067-5715716094AAPK2_HUMAN79-110322A:79-110
C:79-110
32
32
1.4ENST000003712444ENSE00001064901chr1:57158031-57158175145AAPK2_HUMAN111-159492A:111-159
C:111-159
49
49
1.5ENST000003712445ENSE00001064893chr1:57159438-5715952588AAPK2_HUMAN159-188302A:159-188
C:159-188
30
30
1.6ENST000003712446ENSE00001064889chr1:57161608-57161832225AAPK2_HUMAN188-263762A:188-263
C:188-263
76
76
1.7ENST000003712447ENSE00001064891chr1:57169644-57170148505AAPK2_HUMAN263-4311692A:263-431 (gaps)
C:263-431 (gaps)
169
169
1.8ENST000003712448ENSE00001064897chr1:57171765-57171891127AAPK2_HUMAN432-474432A:432-473
C:432-473
42
42
1.9ENST000003712449ENSE00001454729chr1:57173148-571810087861AAPK2_HUMAN474-552792A:532-551
C:532-551
20
20

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:426
 aligned with AAPK2_HUMAN | P54646 from UniProtKB/Swiss-Prot  Length:552

    Alignment length:544
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547    
         AAPK2_HUMAN      8 DGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLA  551
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeee....eeeeeee.....eeeeeeeehhhhhhh.hhhhhhhhhhhhh.........eeeeee...eeeeee.....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee........eee.....eee......ee.................hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh........hhhhhhhhhhhhh...................hhhhhh-------------------------hhhhhhhhhhhhhhhhhhhhhh....----------------..............-------------------.......ee.eee..hhhhhhhhhhhhhhh...eeeeee..eeeeeee......eeeeeeeeeee...eeeeeeee..----------------------------------------------------------..hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-----------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------PROTEIN_KINASE_ATP      -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:8-32    ----------------------------------------------Exon 1.3  PDB: A:79-110         Exon 1.4  PDB: A:111-159 UniProt: 111-159        ----------------------------Exon 1.6  PDB: A:188-263 UniProt: 188-263                                   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:432-473 UniProt: 432-474  ----------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.2  PDB: A:32-79 UniProt: 32-79           -------------------------------------------------------------------------------Exon 1.5  PDB: A:159-188      --------------------------------------------------------------------------Exon 1.7  PDB: A:263-431 (gaps) UniProt: 263-431                                                                                                                         ------------------------------------------Exon 1.9  PDB: A:532-551 UniProt: 474-552 [INCOMPLETE]                         Transcript 1 (2)
                4cfe A    8 DGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRtSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKE-------------------------AVAYHLIIDNRRIMNQASEFYLASSP----------------LKPHPERMPPLIAD-------------------AVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSID----------------------------------------------------------LGSHTMDFFEMCASLITTLA  551
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167    |  177       187       197       207       217       227       237       247       257       267       277       287       | -         -         -   |   327       337        |-         -     | 367        |-         -       397       407       417       427       437       447       457       467     |   -         -         -         -         -         -    |  537       547    
                                                                                                                                                                                              172-TPO                                                                                                                    295                       321                      346              363          376                 396                                                                          473                                                        532                   

Chain B from PDB  Type:PROTEIN  Length:168
 aligned with AAKB1_HUMAN | Q9Y478 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:193
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267   
         AAKB1_HUMAN     78 RPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI  270
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......eeeee.......ee.ee....eeeeee...eeeeeeeee..eee......eee.....eeeeeeehhhhhhhhhhhhhhhhh.----------------....---------....hhhhhhhhhhh.....................eee......eeeeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4cfe B   78 RPTVFRWTGGGKEVYLSGSFNNWSKLPLTRsHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKC----------------EPYV---------PPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI  270
                                    87        97       107|      117       127       137       147       157       167     |   -         -  ||||   -     | 207       217       227       237       247       257       267   
                                                        108-SEP                                                          173             190B|||       203                                                                   
                                                                                                                                          191B||                                                                             
                                                                                                                                           192B|                                                                             
                                                                                                                                            193B                                                                             

Chain C from PDB  Type:PROTEIN  Length:404
 aligned with AAPK2_HUMAN | P54646 from UniProtKB/Swiss-Prot  Length:552

    Alignment length:542
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549  
         AAPK2_HUMAN     10 RVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLA  551
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeee....eeeeeee.....eeeeeeeehhhhhhh.hhhhhhhhhhhhh.........eeeeee...eeeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee........eee.....eee......ee.................hhhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh........hhhhhhhhhhhhh..............------------------------------------------hhhhhhhhhhhhhhhh....----------------...........----------------------.......ee.eee..hhhhhhhhhhhhhhh...eeeeee..eeeeeee......eeeeeeeeeee...eeeeeeee..----------------------------------------------------------..hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-----------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------PROTEIN_KINASE_ATP      -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: C:10-32 ----------------------------------------------Exon 1.3  PDB: C:79-110         Exon 1.4  PDB: C:111-159 UniProt: 111-159        ----------------------------Exon 1.6  PDB: C:188-263 UniProt: 188-263                                   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.8  PDB: C:432-473 UniProt: 432-474  ----------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.2  PDB: C:32-79 UniProt: 32-79           -------------------------------------------------------------------------------Exon 1.5  PDB: C:159-188      --------------------------------------------------------------------------Exon 1.7  PDB: C:263-431 (gaps) UniProt: 263-431                                                                                                                         ------------------------------------------Exon 1.9  PDB: C:532-551 UniProt: 474-552 [INCOMPLETE]                         Transcript 1 (2)
                4cfe C   10 RVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRtSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYD------------------------------------------IIDNRRIMNQASEFYLASSP----------------LKPHPERMPPL----------------------AVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSID----------------------------------------------------------LGSHTMDFFEMCASLITTLA  551
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169  |    179       189       199       209       219       229       239       249       259       269       279    |    -         -         -         -       329       339      |  -         -   |   369   |     -         -      |399       409       419       429       439       449       459       469   |     -         -         -         -         -         -  |    539       549  
                                                                                                                                                                                            172-TPO                                                                                                         284                                        327                346              363       373                    396                                                                          473                                                        532                   

Chain D from PDB  Type:PROTEIN  Length:167
 aligned with AAKB1_HUMAN | Q9Y478 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:193
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267   
         AAKB1_HUMAN     78 RPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI  270
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......eeeee.......ee.ee....eeeeee...eeeeeeeee..eee......eee.....eeeeeeehhhhhhhhhhhhhhh------------------......--------....hhhhhhhhhhh.....................eee......eeeeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4cfe D   78 RPTVFRWTGGGKEVYLSGSFNNWSKLPLTRsHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDS------------------QEPYVC--------PPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI  270
                                    87        97       107|      117       127       137       147       157       167  |      -         - ||||||  -     | 207       217       227       237       247       257       267   
                                                        108-SEP                                                       170               189A|||||      203                                                                   
                                                                                                                                         190A||||                                                                            
                                                                                                                                          191A|||                                                                            
                                                                                                                                           192A||                                                                            
                                                                                                                                            193A|                                                                            
                                                                                                                                             194A                                                                            

Chain E from PDB  Type:PROTEIN  Length:294
 aligned with AAKG1_HUMAN | P54619 from UniProtKB/Swiss-Prot  Length:331

    Alignment length:299
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
         AAKG1_HUMAN     27 SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT  325
               SCOP domains d4cfee1 E:27-182 automated matches                                                                                                                          d4cfee2 E:183-325 automated matches                                                                                                             SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh...hhhhh..eeeeeeee...hhhhhhhhhhhh....eeeee....eeeeeehhhhhhhhhhhh.......hhhhhhhhhhhhhhhh.-----.........hhhhhhhhhhhh...eeeee......eeeeeehhhhhhhhhh.............hhhhhh.........ee...hhhhhhhhhhhhh..eeeee.....eeeeee...hhhhhhh........hhhhhhhhhh.......eee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------CBS  PDB: E:43-103 UniProt: 43-103                           ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) --------------------------------------------------------------------------------------------------CBS  PDB: E:128-187 UniProt: 125-187                           ----------CBS  PDB: E:198-260 UniProt: 198-260                           -----------CBS  PDB: E:272-325 UniProt: 272-329                   PROSITE (1)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4cfe E   27 SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYL-----PLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT  325
                                    36        46        56        66        76        86        96       106       116     |   - |     136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
                                                                                                                         122   128                                                                                                                                                                                                     

Chain F from PDB  Type:PROTEIN  Length:288
 aligned with AAKG1_HUMAN | P54619 from UniProtKB/Swiss-Prot  Length:331

    Alignment length:299
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
         AAKG1_HUMAN     27 SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT  325
               SCOP domains d4cfef1 F:27-182 automated matches                                                                                                                          d4cfef2 F:183-325 automated matches                                                                                                             SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh.hhhh...eeeeeeee...hhhhhhhhhhhh....eeeee....eeeeeehhhhhhhhhhhh.......hhhhhhhhhhhhhhhh------.........hhhhhhhhhhhh...eeeee......eeeeeehhhhhhhhhh.......hhhhhhhhhhhh.........ee...hhhhhhhhhhhhh..eeeee.....eeeeee.hhhhhhhhh........hhhhhhhhhh-----..ee....hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------CBS  PDB: F:43-103 UniProt: 43-103                           ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) --------------------------------------------------------------------------------------------------CBS  PDB: F:128-187 UniProt: 125-187                           ----------CBS  PDB: F:198-260 UniProt: 198-260                           -----------CBS  PDB: F:276-325 UniProt: 272-329                   PROSITE (1)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4cfe F   27 SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY------PLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRS-----VLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT  325
                                    36        46        56        66        76        86        96       106       116    |    - |     136       146       156       166       176       186       196       206       216       226       236       246       256       266   |   276       286       296       306       316         
                                                                                                                        121    128                                                                                                                                           270   276                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CFE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CFE)

(-) Gene Ontology  (75, 109)

Asymmetric Unit(hide GO term definitions)
Chain A,C   (AAPK2_HUMAN | P54646)
molecular function
    GO:0004679    AMP-activated protein kinase activity    Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of AMP.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0050405    [acetyl-CoA carboxylase] kinase activity    Catalysis of the reaction: ATP + [acetyl-CoA carboxylase] = ADP + [acetyl-CoA carboxylase] phosphate.
    GO:0047322    [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity    Catalysis of the reaction: [3-hydroxy-3-methylglutaryl-CoA reductase (NADPH)] + ATP = [3-hydroxy-3-methylglutaryl-CoA reductase (NADPH)] phosphate + ADP.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0035174    histone serine kinase activity    Catalysis of the transfer of a phosphate group to a serine residue of a histone. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004712    protein serine/threonine/tyrosine kinase activity    Catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; ATP + a protein threonine = ADP + protein threonine phosphate; and ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0006853    carnitine shuttle    The transfer of acyl groups to and from acyl-CoA molecules to form O-acylcarnitine, which can exchange across the mitochondrial inner membrane with unacylated carnitine.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0042149    cellular response to glucose starvation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of glucose.
    GO:0031669    cellular response to nutrient levels    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
    GO:0071380    cellular response to prostaglandin E stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin E stimulus.
    GO:0006695    cholesterol biosynthetic process    The chemical reactions and pathways resulting in the formation of cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0055089    fatty acid homeostasis    Any process involved in the maintenance of an internal steady state of fatty acid within an organism or cell.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0042593    glucose homeostasis    Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
    GO:0035404    histone-serine phosphorylation    The modification of histones by addition of a phosphate group to a serine residue.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0032007    negative regulation of TOR signaling    Any process that stops, prevents, or reduces the frequency, rate or extent of TOR signaling.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0010508    positive regulation of autophagy    Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
    GO:0045821    positive regulation of glycolytic process    Any process that activates or increases the frequency, rate or extent of glycolysis.
    GO:0016239    positive regulation of macroautophagy    Any process, such as recognition of nutrient depletion, that activates or increases the rate of macroautophagy to bring cytosolic macromolecules to the vacuole/lysosome for degradation.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0042752    regulation of circadian rhythm    Any process that modulates the frequency, rate or extent of a circadian rhythm. A circadian rhythm is a biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:2000505    regulation of energy homeostasis    Any process that modulates the frequency, rate or extent of energy homeostasis.
    GO:0042304    regulation of fatty acid biosynthetic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of fatty acids, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0016241    regulation of macroautophagy    Any process that modulates the frequency, rate or extent of macroautophagy.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0014850    response to muscle activity    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a muscle activity stimulus.
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0006694    steroid biosynthetic process    The chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus; includes de novo formation and steroid interconversion by modification.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0016126    sterol biosynthetic process    The chemical reactions and pathways resulting in the formation of sterols, steroids with one or more hydroxyl groups and a hydrocarbon side-chain in the molecule.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0031588    nucleotide-activated protein kinase complex    A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D   (AAKB1_HUMAN | Q9Y478)
molecular function
    GO:0004679    AMP-activated protein kinase activity    Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of AMP.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0051291    protein heterooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0045859    regulation of protein kinase activity    Any process that modulates the frequency, rate or extent of protein kinase activity.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0031588    nucleotide-activated protein kinase complex    A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain E,F   (AAKG1_HUMAN | P54619)
molecular function
    GO:0043531    ADP binding    Interacting selectively and non-covalently with ADP, adenosine 5'-diphosphate.
    GO:0016208    AMP binding    Interacting selectively and non-covalently with AMP, adenosine monophosphate.
    GO:0004679    AMP-activated protein kinase activity    Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of AMP.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004691    cAMP-dependent protein kinase activity    Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of cAMP.
    GO:0008603    cAMP-dependent protein kinase regulator activity    Modulation of the activity of the enzyme cAMP-dependent protein kinase.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045860    positive regulation of protein kinase activity    Any process that activates or increases the frequency, rate or extent of protein kinase activity.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0006110    regulation of glycolytic process    Any process that modulates the frequency, rate or extent of glycolysis.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0031588    nucleotide-activated protein kinase complex    A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    992  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    AMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    STU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val D:193A - Cys D:194A  [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cfe
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAKB1_HUMAN | Q9Y478
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  AAKG1_HUMAN | P54619
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  AAPK2_HUMAN | P54646
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.7.11.27
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.7.11.31
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AAKB1_HUMAN | Q9Y478
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  AAKG1_HUMAN | P54619
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  AAPK2_HUMAN | P54646
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAKB1_HUMAN | Q9Y4784cff 4zhx 5ezv 5iso
        AAKG1_HUMAN | P546192uv4 2uv5 2uv6 2uv7 4cff 4rer 4rew 4zhx 5ezv 5iso
        AAPK2_HUMAN | P546462h6d 2ltu 2yza 3aqv 4cff 4zhx 5ezv 5iso

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CFE)