Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CLEAVED ANTICHYMOTRYPSIN T345R
 
Authors :  C. M. Lukacs, D. W. Christianson
Date :  14 Aug 97  (Deposition) - 25 Feb 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Serpin, Serine Protease Inhibitor, Antichymotrypsin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. M. Lukacs, H. Rubin, D. W. Christianson
Engineering An Anion-Binding Cavity In Antichymotrypsin Modulates The "Spring-Loaded" Serpin-Protease Interaction.
Biochemistry V. 37 3297 1998
PubMed-ID: 9521649  |  Reference-DOI: 10.1021/BI972359E
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ANTICHYMOTRYPSIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneACT
    Expression System PlasmidPZMS
    Expression System Taxid562
    GeneACT
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCLEAVED ANTICHYMOTRYPSIN
    SynonymACT
 
Molecule 2 - ANTICHYMOTRYPSIN
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneACT
    Expression System PlasmidPZMS
    Expression System Taxid562
    GeneACT
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCLEAVED ANTICHYMOTRYPSIN
    SynonymACT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4CAA)

(-) Sites  (0, 0)

(no "Site" information available for 4CAA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CAA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4CAA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (6, 6)

Asymmetric/Biological Unit (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006974L78PAACT_HUMANPolymorphism1800463AL55P
2UniProtVAR_006975A167GAACT_HUMANPolymorphism  ---AA144G
3UniProtVAR_006976P252AAACT_HUMANPolymorphism17473AP228A
4UniProtVAR_037902K267RAACT_HUMANPolymorphism17853314AK243R
5UniProtVAR_006977M401VAACT_HUMANUnclassified  ---BM372V
6UniProtVAR_011742D407GAACT_HUMANPolymorphism10956BD378G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SERPINPS00284 Serpins signature.AACT_HUMAN393-403  1B:364-374

(-) Exons   (4, 5)

Asymmetric/Biological Unit (4, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003930801aENSE00001870556chr14:95078634-95078784151AACT_HUMAN1-23230--
1.2dENST000003930802dENSE00001641595chr14:95080771-95081421651AACT_HUMAN23-2402181A:28-217
-
190
-
1.3bENST000003930803bENSE00001368068chr14:95085532-95085805274AACT_HUMAN240-331921A:217-306
-
92
-
1.4aENST000003930804aENSE00001373796chr14:95088678-95088828151AACT_HUMAN331-381511A:306-356
-
51
-
1.5cENST000003930805cENSE00001944703chr14:95089948-95090397450AACT_HUMAN382-448672A:357-358
B:361-393
2
33

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:333
 aligned with AACT_HUMAN | P01011 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:333
                                    60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380   
          AACT_HUMAN     51 SANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLL  383
               SCOP domains d4caa.1 A:,B: Antichymotrypsin, alpha-1                                                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 4caaA02 A:28-193,A:289-342 Antithrombin, subunit I, domain 2                                                                                                          4caaA01 A:194-288,A:348-358 Alpha-1-antitrypsin, domain 1                                        4caaA02 A:28-193,A:289-342                            -----4caaA01     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh...hhhhhhhhhh.........hhhhhhhhhhhhhhh.......eeeeeeeeeee......hhhhhhhhhh....eeee.hhhhhhhhhhhhhhhhhh...............eeeeeeeeeeee........hhh.eeeeeeee..eeeeeeeeeee.eeeeeeee....eeeeeee.....eeeeeee....hhhhhhh..hhhhhhhhhh.eeeee.eeeee.eeeeeeee.hhhhhh....hhh......hhhh....eeeeeeeeeeeeeee..eeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------P----------------------------------------------------------------------------------------G------------------------------------------------------------------------------------A--------------R-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2d  PDB: A:28-217 UniProt: 23-240 [INCOMPLETE]                                                                                                                                         ------------------------------------------------------------------------------------------Exon 1.4a  PDB: A:306-356 UniProt: 331-381         1. Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.3b  PDB: A:217-306 UniProt: 240-331                                                  ---------------------------------------------------- Transcript 1 (2)
                4caa A   28 SANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGREASAATAVKITLL  358
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217      226A       236       246       256       266       276  |    285       295       305       315       325       335       345       355   
                                                                                                                                                                                                                                226A                                                 278A                                                                                

Chain B from PDB  Type:PROTEIN  Length:33
 aligned with AACT_HUMAN | P01011 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:33
                                   399       409       419   
          AACT_HUMAN    390 RTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQ  422
               SCOP domains d4caa.1 A:,B:                     SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author .........eeeee.........eeeee..... Sec.struct. author
                 SAPs(SNPs) -----------V-----G--------------- SAPs(SNPs)
                    PROSITE ---SERPIN     ------------------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: B:361-393         Transcript 1 (1)
           Transcript 1 (2) --------------------------------- Transcript 1 (2)
                4caa B  361 RTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQ  393
                                   370       380       390   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CAA)

(-) Gene Ontology  (18, 18)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (AACT_HUMAN | P01011)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0030277    maintenance of gastrointestinal epithelium    Protection of epithelial surfaces of the gastrointestinal tract from proteolytic and caustic digestive agents.
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0019216    regulation of lipid metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving lipids.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4caa)
 
  Sites
(no "Sites" information available for 4caa)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4caa)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4caa
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AACT_HUMAN | P01011
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AACT_HUMAN | P01011
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AACT_HUMAN | P010111as4 1qmn 2ach 3caa 3dlw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CAA)