4BQA - JenaLib

Asymmetric Unit (3, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ETS_DOMAIN_3	PS50061	Ets-domain profile.	ETS2_HUMAN	363-443	3	A:363-443 D:363-443 G:363-443
2	ETS_DOMAIN_1	PS00345	Ets-domain signature 1.	ETS2_HUMAN	365-373	3	A:365-373 D:365-373 G:365-373
3	ETS_DOMAIN_2	PS00346	Ets-domain signature 2.	ETS2_HUMAN	409-424	3	A:409-424 D:409-424 G:409-424

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ETS_DOMAIN_3	PS50061	Ets-domain profile.	ETS2_HUMAN	363-443	1	A:363-443 - -
2	ETS_DOMAIN_1	PS00345	Ets-domain signature 1.	ETS2_HUMAN	365-373	1	A:365-373 - -
3	ETS_DOMAIN_2	PS00346	Ets-domain signature 2.	ETS2_HUMAN	409-424	1	A:409-424 - -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ETS_DOMAIN_3	PS50061	Ets-domain profile.	ETS2_HUMAN	363-443	1	- - G:363-443
2	ETS_DOMAIN_1	PS00345	Ets-domain signature 1.	ETS2_HUMAN	365-373	1	- - G:365-373
3	ETS_DOMAIN_2	PS00346	Ets-domain signature 2.	ETS2_HUMAN	409-424	1	- - G:409-424

Biological Unit 3 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ETS_DOMAIN_3	PS50061	Ets-domain profile.	ETS2_HUMAN	363-443	1	- D:363-443 -
2	ETS_DOMAIN_1	PS00345	Ets-domain signature 1.	ETS2_HUMAN	365-373	1	- D:365-373 -
3	ETS_DOMAIN_2	PS00346	Ets-domain signature 2.	ETS2_HUMAN	409-424	1	- D:409-424 -

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:132
 aligned with ETS2_HUMAN | P15036 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:132
                                   338       348       358       368       378       388       398       408       418       428       438       448       458  
           ETS2_HUMAN   329 MSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAI 460
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhh...........hhhhhhhhhh....hhhhhhhhhhhhhhhh...ee.....eee..hhhhhhhhhhhhhh....hhhhhhhhhhh......eee......eeee..hhhhhhh.hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------------------ETS_DOMAIN_3  PDB: A:363-443 UniProt: 363-443                                    ----------------- PROSITE (1)
                PROSITE (2) ------------------------------------ETS_DOMAI-----------------------------------ETS_DOMAIN_2    ------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4bqa A 329 MSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAI 460
                                   338       348       358       368       378       388       398       408       418       428       438       448       458

Chain B from PDB  Type:DNA  Length:10
                                          
                 4bqa B   1 ACCGGAAGTG  10
                                    10

Chain C from PDB  Type:DNA  Length:10
                                          
                 4bqa C   1 CACTTCCGGT  10
                                    10

Chain D from PDB  Type:PROTEIN  Length:84
 aligned with ETS2_HUMAN | P15036 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:84
                                   370       380       390       400       410       420       430       440    
           ETS2_HUMAN   361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC 444
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh......ee.....eee..hhhhhhhhhhhhh.....hhhhhhhhhhhhhh...eee......eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ETS_DOMAIN_3  PDB: D:363-443 UniProt: 363-443                                    - PROSITE (1)
                PROSITE (2) ----ETS_DOMAI-----------------------------------ETS_DOMAIN_2    -------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 4bqa D 361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC 444
                                   370       380       390       400       410       420       430       440

Chain E from PDB  Type:DNA  Length:10
                                          
                 4bqa E   1 ACCGGAAGTG  10
                                    10

Chain F from PDB  Type:DNA  Length:10
                                          
                 4bqa F   1 CACTTCCGGT  10
                                    10

Chain G from PDB  Type:PROTEIN  Length:85
 aligned with ETS2_HUMAN | P15036 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:85
                                   370       380       390       400       410       420       430       440     
           ETS2_HUMAN   361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD 445
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh.ee.....eee..hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.eee......eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --ETS_DOMAIN_3  PDB: G:363-443 UniProt: 363-443                                    -- PROSITE (1)
                PROSITE (2) ----ETS_DOMAI-----------------------------------ETS_DOMAIN_2    --------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 4bqa G 361 GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD 445
                                   370       380       390       400       410       420       430       440

Chain H from PDB  Type:DNA  Length:10
                                          
                 4bqa H   1 ACCGGAAGTG  10
                                    10

Chain I from PDB  Type:DNA  Length:10
                                          
                 4bqa I   1 CACTTCCGGT  10
                                    10

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (22, 22)

Asymmetric Unit(hide GO term definitions)

Chain A,D,G (ETS2_HUMAN | P15036)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
	GO:0035259	glucocorticoid receptor binding	Interacting selectively and non-covalently with a glucocorticoid receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0001712	ectodermal cell fate commitment	The cell differentiation process that results in commitment of a cell to become part of the ectoderm.
	GO:0007498	mesoderm development	The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0090009	primitive streak formation	The developmental process pertaining to the initial formation of the primitive streak from unspecified parts. The primitive streak is a ridge of cells running along the midline of the embryo where the mesoderm ingresses. It defines the anterior-posterior axis.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0001501	skeletal system development	The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4bqa
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ETS2_HUMAN \| P15036
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 9)