Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ORF CHEMOKINE BINDING PROTEIN COMPLEXED WITH CCL7
 
Authors :  K. M. Knapp, Y. Nakatani, K. L. Krause
Date :  30 Apr 15  (Deposition) - 08 Jul 15  (Release) - 15 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.15
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Complex, Orf Virus Chemokine Binding Protein, Ccl7 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. M. Counago, K. M. Knapp, Y. Nakatani, S. B. Fleming, M. Corbett, L. M. Wise, A. A. Mercer, K. L. Krause
Structures Of Orf Virus Chemokine Binding Protein In Comple With Host Chemokines Reveal Clues To Broad Binding Specificity.
Structure V. 23 1199 2015
PubMed-ID: 26095031  |  Reference-DOI: 10.1016/J.STR.2015.04.023

(-) Compounds

Molecule 1 - CHEMOKINE BINDING PROTEIN
    Chains: A
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK 293-6E
    Expression System Common: HUMAN
    Expression System Plasmid: PTT5
    Expression System Taxid: 9606
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 17-286
    Organism Common: ORFV
    Organism Scientific: ORF VIRUS (STRAIN NZ2)
    Organism Taxid: 10259
 
Molecule 2 - C-C MOTIF CHEMOKINE 7
    Chains: B
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK 293-6E
    Expression System Common: HUMAN
    Expression System Plasmid: PTT5
    Expression System Taxid: 9606
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 24-99
    Gene: CCL7, MCP3, SCYA6, SCYA7
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: MONOCYTE CHEMOATTRACTANT PROTEIN 3,MONOCYTE CHEMOTACTIC PROTEIN 3,MCP-3,NC28,SMALL-INDUCIBLE CYTOKINE A7

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:80 , GLN A:147 , ASP A:151binding site for Poly-Saccharide residues NAG A 301 through NAG A 302 bound to ASN A 80
2AC2SOFTWARETYR A:96 , LEU A:99 , GLY A:100 , ASN A:113 , ILE A:252 , LYS A:253 , ASP A:254 , MET A:261binding site for Poly-Saccharide residues NAG A 303 through BMA A 305 bound to ASN A 113

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1A:18 -A:227
2A:49 -A:262
3A:150 -A:213
4B:11 -B:36
5B:12 -B:52

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZKC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZKC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZKC)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZKC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:217
                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.....eeeeeeeeeee...........eeeeeeee..........eeeeeeeeee..eeeeeeeeee.....eeeeeeee......eeeeeeeee...........hhhhhhhhhhhhhh.eeeeeee.............eeeee....eeeeeeeeeeee.hhhhh.....eeeeee.hhhhhhhhhh......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zkc A  11 SEEKANFCSTHNDEVYARFRLQMRVGVRHSPLYTPSNMCMLDIEDSVEDIEESTEKEYASTATGEAAGVNVSVALVGEGVSIPFSYIGLGFNPSLEDSYLYVNVSSRAPWVKQTSDLSANGGWGIKQVLEKELLAIQIGCDNQKFPEPADIDFSLLVDPRCVTSVDLHVELRDACIDYKQESPLSLKGKYGDGELVKKEIKDVGKNHNMCSLNLNPG 269
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150      |202       212       222       232       242       252       262       
                                                                                                                                                                            157|                                                                     
                                                                                                                                                                             200                                                                     


Chain B from PDB  Type:PROTEIN  Length:60
                                                                                            
               SCOP domains ------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee............eeeeee..........eeeee.....eee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------ Transcript
                 4zkc B   9 TTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLD  68
                                    18        28        38        48        58        68
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZKC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZKC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZKC)

(-) Gene Ontology  (32, 32)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zkc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zkc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CCL7_HUMAN | P80098
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q2F862_ORFV | Q2F862
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CCL7_HUMAN | P80098
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q2F862_ORFV | Q2F862
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CCL7_HUMAN | P80098: 1bo0 1ncv
UniProtKB/TrEMBL
        Q2F862_ORFV | Q2F862: 4p5i 4zk9 4zkb

(-) Related Entries Specified in the PDB File

4zk9 4zkb