Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CYTOCHROME P450 WILD TYPE FROM BM3 WITH BOUND PEG
 
Authors :  W. E. Rogers, T. Othman, D. K. Heidary, T. Huxford
Date :  21 Apr 15  (Deposition) - 13 Jul 16  (Release) - 13 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.77
Chains :  Asym./Biol. Unit :  A
Keywords :  Cytochrome P450, Heme Oxidase Domain, Oxidoreductase, Bacillus Megaterium (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Geronimo, C. A. Denning, W. E. Rogers, T. Othman, T. Huxford, D. K. Heidary, E. C. Glazer, C. M. Payne
Effect Of Mutation And Substrate Binding On The Stability O Cytochrome P450Bm3 Variants.
Biochemistry V. 55 3594 2016
PubMed-ID: 27267136  |  Reference-DOI: 10.1021/ACS.BIOCHEM.6B00183

(-) Compounds

Molecule 1 - BIFUNCTIONAL P-450/NADPH-P450 REDUCTASE
    ChainsA
    EC Number1.14.14.1, 1.6.2.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21
    Expression System Taxid511693
    FragmentUNP RESIDUES 1-461
    GeneCYP102A1, CYP102
    MutationYES
    Organism ScientificBACILLUS MEGATERIUM
    Organism Taxid1404
    SynonymCYTOCHROME P450(BM-3),CYTOCHROME P450BM-3

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
11PE1Ligand/IonPENTAETHYLENE GLYCOL
2EDO1Ligand/Ion1,2-ETHANEDIOL
3HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
4NI4Ligand/IonNICKEL (II) ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:69 , LEU A:86 , PHE A:87 , TRP A:96 , PHE A:107 , PHE A:261 , ALA A:264 , GLY A:265 , THR A:268 , THR A:269 , THR A:327 , PHE A:331 , PRO A:392 , PHE A:393 , GLY A:394 , ARG A:398 , CYS A:400 , ILE A:401 , GLY A:402 , ALA A:406 , EDO A:503 , HOH A:612 , HOH A:618 , HOH A:622 , HOH A:625 , HOH A:626 , HOH A:638binding site for residue HEM A 501
2AC2SOFTWAREPHE A:87 , LEU A:188 , ALA A:330 , LEU A:437 , HOH A:611binding site for residue 1PE A 502
3AC3SOFTWAREPHE A:87 , ALA A:264 , THR A:268 , HEM A:501binding site for residue EDO A 503
4AC4SOFTWARETHR A:1 , ASP A:338 , GLU A:348binding site for residue NI A 504
5AC5SOFTWAREHIS A:138 , HIS A:426binding site for residue NI A 505
6AC6SOFTWAREGLU A:252 , HIS A:285 , HOH A:650binding site for residue NI A 506
7AC7SOFTWAREASP A:231 , HIS A:236binding site for residue NI A 507

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZFA)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:226 -Gly A:227

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZFA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZFA)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZFA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:460
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhh..hhhhhhhhhhhhhh.eeeee....eeeee.hhhhhhhhh....eee..hhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhh....eeeeee...eeehhheee....eeeeehhhhh.hhhhhh......hhhhhhhhhhh.........hhhhh..hhhhhhhhhhhhhhhhhhheeee........eee...eee...eeeeee.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zfa A   1 TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPS 460
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZFA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZFA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZFA)

(-) Gene Ontology  (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:226 - Gly A:227   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zfa
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CPXB_BACMB | P14779
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.14.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  1.6.2.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CPXB_BACMB | P14779
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CPXB_BACMB | P147791bu7 1bvy 1fag 1fah 1jme 1jpz 1p0v 1p0w 1p0x 1smi 1smj 1yqo 1yqp 1zo4 1zo9 1zoa 2bmh 2hpd 2ij2 2ij3 2ij4 2j1m 2j4s 2nnb 2uwh 2x7y 2x80 3ben 3cbd 3dgi 3ekb 3ekd 3ekf 3hf2 3kx3 3kx4 3kx5 3m4v 3npl 3psx 3wsp 4dqk 4dql 4dtw 4dty 4dtz 4du2 4dua 4dub 4duc 4dud 4due 4duf 4h23 4h24 4hgf 4hgg 4hgh 4hgi 4hgj 4kew 4key 4kf0 4kf2 4kpa 4kpb 4o4p 4rsn 4wg2 4zf6 4zf8 4zfb 5b2u 5b2v 5b2w 5b2x 5b2y 5dyp 5dyz 5e78 5e7y 5e9z 5jq2 5jqu 5jqv 5jtd

(-) Related Entries Specified in the PDB File

4zf6 4zf8 4zf9 4zfb 4zfd 4zfe