Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CD1A TERNARY COMPLEX WITH ENDOGENOUS LIPIDS AND BK6 TCR
 
Authors :  R. W. Birkinshaw, J. Rossjohn
Date :  08 Dec 14  (Deposition) - 28 Jan 15  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.98
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,G,H  (1x)
Biol. Unit 2:  C,D,E,F  (1x)
Keywords :  Cd1A, Tcr, Immune Complex, Lipid Antigen, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. W. Birkinshaw, D. G. Pellicci, T. Y. Cheng, A. N. Keller, M. Sandoval-Romero, S. Gras, A. De Jong, A. P. Uldrich, D. B. Moody, D. I. Godfrey, J. Rossjohn
Alpha Beta T Cell Antigen Receptor Recognition Of Cd1A Presenting Self Lipid Ligands.
Nat. Immunol. V. 16 258 2015
PubMed-ID: 25642819  |  Reference-DOI: 10.1038/NI.3098

(-) Compounds

Molecule 1 - T-CELL SURFACE GLYCOPROTEIN CD1A
    Chains: A, C
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Gene: CD1A
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: T-CELL SURFACE ANTIGEN T6/LEU-6,HTA1 THYMOCYTE ANTIGEN
 
Molecule 2 - BETA-2-MICROGLOBULIN
    Chains: B, D
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Gene: B2M, CDABP0092, HDCMA22P
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 3 - TCR ALPHA
    Chains: E, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 4 - TCR BETA
    Chains: F, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): AB    GH
Biological Unit 2 (1x):   CDEF  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric Unit (4, 8)
No.NameCountTypeFull Name
1FUC2Ligand/IonALPHA-L-FUCOSE
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
3OLA1Ligand/IonOLEIC ACID
4PAM1Ligand/IonPALMITOLEIC ACID
Biological Unit 1 (3, 4)
No.NameCountTypeFull Name
1FUC1Ligand/IonALPHA-L-FUCOSE
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3OLA1Ligand/IonOLEIC ACID
4PAM-1Ligand/IonPALMITOLEIC ACID
Biological Unit 2 (3, 4)
No.NameCountTypeFull Name
1FUC1Ligand/IonALPHA-L-FUCOSE
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3OLA-1Ligand/IonOLEIC ACID
4PAM1Ligand/IonPALMITOLEIC ACID

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:73 , CYS A:166 , PHE A:169binding site for residue OLA A 304
2AC2SOFTWARETRP C:14 , HIS C:38 , PHE C:70 , ARG C:73 , THR C:158 , LEU C:162 , PHE C:169binding site for residue PAM C 304
3AC3SOFTWAREASN A:57 , PHE A:58 , GLU A:62 , ARG A:168binding site for Poly-Saccharide residues NAG A 301 through NAG A 303 bound to ASN A 57
4AC4SOFTWAREASN C:57 , PHE C:58 , ARG C:168 , ASP C:175binding site for Poly-Saccharide residues FUC C 301 through NAG C 303 bound to ASN C 57

(-) SS Bonds  (15, 15)

Asymmetric Unit
No.Residues
1A:102 -A:166
2A:206 -A:261
3B:25 -B:80
4C:102 -C:166
5D:25 -D:80
6E:22 -E:88
7E:135 -E:185
8E:160 -F:172
9F:23 -F:91
10F:146 -F:211
11G:22 -G:88
12G:135 -G:185
13G:160 -H:172
14H:23 -H:91
15H:146 -H:211

(-) Cis Peptide Bonds  (14, 14)

Asymmetric Unit
No.Residues
1Tyr A:92 -Pro A:93
2Tyr A:212 -Pro A:213
3His B:31 -Pro B:32
4Tyr C:212 -Pro C:213
5His D:31 -Pro D:32
6Gly E:8 -Pro E:9
7Leu E:94 -Pro E:95
8Thr F:7 -Pro F:8
9Pro F:39 -Gly F:40
10Tyr F:152 -Pro F:153
11Gly G:8 -Pro G:9
12Leu G:94 -Pro G:95
13Thr H:7 -Pro H:8
14Tyr H:152 -Pro H:153

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X6D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X6D)

(-) Exons   (0, 0)

(no "Exon" information available for 4X6D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:267
                                                                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee...eeeeeee..eeeeeee....eeee.hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh...........eeeeeeeeee....eeeeeeeeee..eeeeeee..eeee...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.......eeeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeeee.hhh...eeeeehhhhh...eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d A   7 PLSFHVIWIASFKQNLVSGWLSDLQTHTWDSNSSTIVFLWPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWE 278
                                    16 ||     31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       
                                      18|                                                                                                                                                                                                                                                              
                                       24                                                                                                                                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:86
                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee.........eeeeeeeeee....eee...ee...ee.....eeeeeeeee.........eeeee......eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------- Transcript
                 4x6d B   1 IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKW  95
                                    10        20        30       |49        59        69        79        89      
                                                                38|                                               
                                                                 48                                               

Chain C from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeee......eeeeeeee..eeeee........ee.........hhhhhhhhhhhhhhhhhhhhhhhh..hhhhh....eeeeeeeeeeee..eeeeeeeeeee...eeeeee..eeee...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.............eeeee........eeeeee.....eeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d C   7 PLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPLSHCHVSGFYPKPVWVQRGDILPSADGTWYLRATSSL 268
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186|| ||  211      |233       243    ||  
                                                                                                                                                                                                              187| ||         218|              248|  
                                                                                                                                                                                                               191 ||          231               266  
                                                                                                                                                                                                                 193|                                 
                                                                                                                                                                                                                  206                                 

Chain D from PDB  Type:PROTEIN  Length:78
                                                                                                              
               SCOP domains ------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeee..eeeeeeee.....eeeeee..ee....ee...ee.....eeeeeee...eeee.......eee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------ Transcript
                 4x6d D   1 IQRTPKIQVYSFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEYACRVNHVTLSQPKIVKWD  96
                                    10||      30        40        50        60        78        88        
                                     11|                                             69|                  
                                      22                                              78                  

Chain E from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee....eeee....eeeeeee....eeeeeeeee.....eeeeeeee..eeeee..eeeeee....eeeeee...hhhhheeeeeeeee........ee...eeeeee........eeeee...eeeee................ee...eeeeehhhheeeeeeeee.hhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d E   2 EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP 201
                                    11        21        31        41        51        61        71        81        91       101       111       121    || 137       147       157       167       177||     192         
                                                                                                                                                      126|                                          178|                 
                                                                                                                                                       133                                           184                 

Chain F from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeeee....eeeeeee.....eeeeeee.....eeeeeeeee..eeee......eeee.....eeeeee...hhhhheeeeeeee..........ee...eeeeee.hhhhh...eeeee..hhhhhhhhheeeeeeeeeee....eeeeeee..eee...eee....ee.........eeeeeeeeeehhhhh....eeeeeeee..................eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d F   3 GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR 243
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 

Chain G from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee....eeee....eeeeeee....eeeeeeeee......eeeeeee..eeeee..eeeeee....eeeeee...hhhhheeeeeeeee........ee...eeeeee........eeeeeee......eeeeee................ee...eeeeehhhheeeeeeeee......hhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d G   2 EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP 201
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201

Chain H from PDB  Type:PROTEIN  Length:242
                                                                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeeee....eeeeeee.....eeeeeee.....eeeeeeeee..eeee......eeee.....eeeeee...hhhhheeeeeeee..........ee...eeeeee.hhhhh...eeeeee.hhhhhhhhheeeeeeeeeee....eeeeeee..eee...eee....ee.........eeeeeeeeeehhhhh....eeeeeeee..................eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x6d H   3 GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA 244
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X6D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X6D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X6D)

(-) Gene Ontology  (66, 83)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PAM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly E:8 - Pro E:9   [ RasMol ]  
    Gly G:8 - Pro G:9   [ RasMol ]  
    His B:31 - Pro B:32   [ RasMol ]  
    His D:31 - Pro D:32   [ RasMol ]  
    Leu E:94 - Pro E:95   [ RasMol ]  
    Leu G:94 - Pro G:95   [ RasMol ]  
    Pro F:39 - Gly F:40   [ RasMol ]  
    Thr F:7 - Pro F:8   [ RasMol ]  
    Thr H:7 - Pro H:8   [ RasMol ]  
    Tyr A:212 - Pro A:213   [ RasMol ]  
    Tyr A:92 - Pro A:93   [ RasMol ]  
    Tyr C:212 - Pro C:213   [ RasMol ]  
    Tyr F:152 - Pro F:153   [ RasMol ]  
    Tyr H:152 - Pro H:153   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x6d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2MG_HUMAN | P61769
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CD1A_HUMAN | P06126
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TCA_HUMAN | P01848
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TRBC1_HUMAN | P01850
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B2MG_HUMAN | P61769
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CD1A_HUMAN | P06126
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TCA_HUMAN | P01848
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRBC1_HUMAN | P01850
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B2MG_HUMAN | P61769: 1a1m 1a1n 1a1o 1a6z 1a9b 1a9e 1agb 1agc 1agd 1age 1agf 1akj 1ao7 1b0g 1b0r 1bd2 1c16 1ce6 1cg9 1de4 1duy 1duz 1e27 1e28 1eey 1eez 1efx 1exu 1gzp 1gzq 1hhg 1hhh 1hhi 1hhj 1hhk 1hla 1hsa 1hsb 1i1f 1i1y 1i4f 1i7r 1i7t 1i7u 1im3 1im9 1jf1 1jgd 1jge 1jht 1jnj 1k5n 1kpr 1ktl 1lds 1lp9 1m05 1m6o 1mhe 1mi5 1n2r 1of2 1oga 1ogt 1onq 1p7q 1py4 1q94 1qew 1qlf 1qqd 1qr1 1qrn 1qse 1qsf 1qvo 1r3h 1s8d 1s9w 1s9x 1s9y 1sys 1syv 1t1w 1t1x 1t1y 1t1z 1t20 1t21 1t22 1tmc 1tvb 1tvh 1uqs 1ur7 1uxs 1uxw 1vgk 1w0v 1w0w 1w72 1x7q 1xh3 1xr8 1xr9 1xz0 1ydp 1ypz 1zhk 1zhl 1zs8 1zsd 1zt4 1zvs 2a83 2ak4 2av1 2av7 2axf 2axg 2bck 2bnq 2bnr 2bsr 2bss 2bst 2bvo 2bvp 2bvq 2c7u 2cii 2cik 2clr 2d31 2d4d 2d4f 2dyp 2e8d 2esv 2f53 2f54 2f74 2f8o 2fyy 2fz3 2git 2gj6 2gt9 2gtw 2gtz 2guo 2h26 2h6p 2hjk 2hjl 2hla 2hn7 2j8u 2jcc 2nw3 2nx5 2p5e 2p5w 2po6 2pye 2rfx 2uwe 2v2w 2v2x 2vb5 2vlj 2vlk 2vll 2vlr 2x4n 2x4o 2x4p 2x4q 2x4r 2x4s 2x4t 2x4u 2x70 2x89 2xks 2xku 2xpg 2ypk 2ypl 2yxf 2z9t 3am8 3b3i 3b6s 3bgm 3bh8 3bh9 3bhb 3bo8 3bp4 3bp7 3bvn 3bw9 3bwa 3bxn 3bze 3bzf 3c9n 3cdg 3cii 3ciq 3czf 3d18 3d25 3d2u 3d39 3d3v 3dbx 3dhj 3dhm 3dtx 3dx6 3dx7 3dx8 3dxa 3ekc 3ffc 3fqn 3fqr 3fqt 3fqu 3fqw 3fqx 3ft2 3ft3 3ft4 3giv 3gjf 3gsn 3gso 3gsq 3gsr 3gsu 3gsv 3gsw 3gsx 3h7b 3h9h 3h9s 3hae 3hcv 3hg1 3hla 3hpj 3huj 3i6g 3i6k 3i6l 3ib4 3ixa 3jts 3kla 3kpl 3kpm 3kpn 3kpo 3kpp 3kpq 3kpr 3kps 3kww 3kxf 3kyn 3kyo 3l3d 3l3g 3l3i 3l3j 3l3k 3lkn 3lko 3lkp 3lkq 3lkr 3lks 3ln4 3ln5 3low 3loz 3lv3 3m17 3m1b 3mgo 3mgt 3mr9 3mrb 3mrc 3mrd 3mre 3mrf 3mrg 3mrh 3mri 3mrj 3mrk 3mrl 3mrm 3mrn 3mro 3mrp 3mrq 3mrr 3mv7 3mv8 3mv9 3myj 3myz 3mzt 3na4 3nfn 3o3a 3o3b 3o3d 3o3e 3o4l 3ov6 3ox8 3oxr 3oxs 3pwj 3pwl 3pwn 3pwp 3qda 3qdg 3qdj 3qdm 3qeq 3qfd 3qfj 3qzw 3rew 3rl1 3rl2 3rwj 3s6c 3sdx 3sjv 3skm 3sko 3spv 3t8x 3tid 3tie 3tlr 3tm6 3to2 3tzv 3u0p 3upr 3utq 3uts 3utt 3v5d 3v5h 3v5k 3vcl 3vfm 3vfn 3vfo 3vfp 3vfr 3vfs 3vft 3vfu 3vfv 3vfw 3vh8 3vri 3vrj 3vwj 3vwk 3vxm 3vxn 3vxo 3vxp 3vxr 3vxs 3vxu 3w0w 3w39 3wl9 3wlb 3wuw 3x11 3x12 3x13 3x14 4e0k 4e0l 4e5x 4en3 4eup 4f7m 4f7p 4f7t 4ftv 4fxl 4g8g 4g8i 4g9d 4g9f 4gkn 4gks 4gup 4hkj 4hwz 4hx1 4i48 4i4w 4jfd 4jfe 4jff 4jfo 4jfp 4jfq 4jqv 4jqx 4jrx 4jry 4k71 4k7f 4kdt 4l29 4l3c 4l3e 4l4t 4l4v 4lcw 4lcy 4lhu 4lnr 4m8v 4mj5 4mj6 4mji 4mnq 4n0f 4n0u 4n8v 4nnx 4nny 4no0 4no2 4no3 4no5 4nqc 4nqd 4nqe 4nqv 4nqx 4nt6 4o2c 4o2e 4o2f 4ono 4pj5 4pj7 4pj8 4pj9 4pja 4pjb 4pjc 4pjd 4pje 4pjf 4pjg 4pjh 4pji 4pjx 4pr5 4pra 4prb 4prd 4pre 4prh 4pri 4prn 4prp 4qok 4qrp 4qrq 4qrr 4qrs 4qrt 4qru 4r9h 4ra3 4rah 4rmq 4rmr 4rms 4rmt 4rmu 4rmv 4rmw 4u1h 4u1i 4u1j 4u1k 4u1l 4u1m 4u1n 4u1s 4u6x 4u6y 4uq2 4uq3 4wc8 4wdi 4wj5 4wo4 4wu5 4wu7 4wuu 4ww2 4wwk 4x0s 4x6c 4x6e 4x6f 4xxc 4z76 4z77 4z78 4zez 5b38 5b39 5bjt 5brz 5bs0 5bxf 5c07 5c08 5c09 5c0a 5c0b 5c0c 5c0d 5c0e 5c0f 5c0g 5c0i 5c0j 5c9j 5cfh 5cka 5ckg 5cs7 5csb 5csg 5d2l 5d2n 5d5m 5d7i 5d7j 5d7l 5d9s 5ddh 5def 5deg 5e00 5e6i 5e9d 5enw 5eo0 5eo1 5eot 5eu3 5eu4 5eu5 5eu6 5euo 5f7d 5f9j 5fa3 5fa4 5fdw 5gr7 5gsb 5gsr 5gsv 5gsx 5hga 5hgb 5hgd 5hgh 5hhm 5hhn 5hho 5hhp 5hhq 5hyj 5ib1 5ib2 5ib3 5ib4 5ib5 5ieh 5iek 5im7 5inc 5ind 5iro 5isz 5iue 5j1a 5jhd 5jzi 5knm 5l2j 5l2k 5men 5meo 5mep 5meq 5mer 5n1y 5swq 5t6w 5t6x 5t6y 5t6z 5t70 5u16 5u17 5u1r 5u2v 5u6q 5u72 5v5l 5v5m 5vgd 5vge 5xos 5xot 5xov
        CD1A_HUMAN | P06126: 1onq 1xz0 4x6c 4x6e 4x6f 5j1a
        TCA_HUMAN | P01848: 1ao7 1bd2 1fyt 1j8h 1kgc 1mi5 1oga 1qrn 1qsf 1ymm 1zgl 2ak4 2bnq 2bnr 2bnu 2cdf 2cdg 2esv 2eyr 2eys 2eyt 2f53 2f54 2gj6 2ial 2iam 2ian 2nx5 2p5e 2p5w 2po6 2pye 2pyf 2vlj 2vlk 2vlm 2vlr 2xn9 2xna 3arb 3ard 3are 3arf 3arg 3d39 3dx9 3dxa 3ffc 3gsn 3he7 3hg1 3kpr 3kps 3kxf 3o4l 3o6f 3o8x 3o9w 3pwp 3qdg 3qdj 3qdm 3qeq 3qeu 3qib 3qjf 3qux 3scm 3sda 3sdc 3sdd 3sdx 3sjv 3skn 3t0e 3tn0 3tvm 4apq 4c56 4g8e 4g8f 4irs 4jfd 4jfe 4jff 4jfh 4jrx 4jry 4mvb 4mxq 4n0c 4n5e 4nhu 4onh 4p4k 4prh 4pri 4prp 4udt 4udu 4ww1 4ww2 4wwk 4x6b 4x6c 4y16 4y2d 4y4f 4y4h 4y4k 4zdh 4zez 5brz 5bs0 5c07 5c08 5c09 5c0a 5c0b 5c0c 5eu6 5fk9 5fka 5hhm 5hho 5hyj 5ks9 5ksa 5ksb
        TRBC1_HUMAN | P01850: 1ao7 1fyt 1j8h 1kgc 1ktk 1mi5 1oga 1ymm 1zgl 2ak4 2axh 2bnq 2bnr 2bnu 2cde 2cdf 2cdg 2esv 2f53 2f54 2gj6 2ial 2iam 2ian 2nts 2nw2 2nx5 2p5e 2p5w 2po6 2pye 2pyf 2vlj 2vlk 2vlm 2vlr 2xn9 2xna 3arb 3ard 3are 3arf 3arg 3d39 3d3v 3dx9 3dxa 3ffc 3he6 3hg1 3kpr 3kps 3o4l 3tn0 4g8e 4g8f 4gg6 4gg8 4iiq 4jfd 4jfe 4jff 4jfh 4jrx 4jry 4l4t 4l4v 4l9l 4lcc 4lcw 4mji 4mnq 4nqc 4nqd 4nqe 4ozf 4ozg 4ozh 4ozi 4p46 4prh 4pri 4prp 4x6b 4x6c 4zdh

(-) Related Entries Specified in the PDB File

4x6b 4x6c 4x6e 4x6f