Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE CDC25B PHOSPHATASE CATALYTIC DOMAIN WITH BOUND LIGAND
 
Authors :  G. L. Lund, S. Dudkin, D. Borkin, W. Ni, J. Grembecka, T. Cierpicki
Date :  20 Sep 14  (Deposition) - 10 Dec 14  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.62
Chains :  Asym./Biol. Unit :  A
Keywords :  Phosphatase, Inhibitor, Fragment, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Lund, S. Dudkin, D. Borkin, W. Ni, J. Grembecka, T. Cierpicki
Inhibition Of Cdc25B Phosphatase Through Disruption Of Protein-Protein Interaction.
Acs Chem. Biol. V. 10 390 2015
PubMed-ID: 25423142  |  Reference-DOI: 10.1021/CB500883H

(-) Compounds

Molecule 1 - M-PHASE INDUCER PHOSPHATASE 2
    Chains: A
    EC Number: 3.1.3.48
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: CATALYTIC DOMAIN (UNP RESIDUES 386-565)
    Gene: CDC25B, CDC25HU2
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: DUAL SPECIFICITY PHOSPHATASE CDC25B

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric/Biological Unit (3, 8)
No.NameCountTypeFull Name
18H81Ligand/Ion2-FLUORO-4-HYDROXYBENZONITRILE
2GOL1Ligand/IonGLYCEROL
3SO46Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:473 , GLU A:474 , PHE A:475 , SER A:476 , SER A:477 , GLU A:478 , ARG A:479 , HOH A:982binding site for residue SO4 A 601
2AC2SOFTWAREGLY A:393 , LYS A:394 , LYS A:509 , HOH A:813 , HOH A:822 , HOH A:888 , HOH A:892 , HOH A:918binding site for residue SO4 A 602
3AC3SOFTWAREARG A:488 , ARG A:492 , 8H8 A:607 , HOH A:737binding site for residue SO4 A 603
4AC4SOFTWAREILE A:417 , ARG A:466 , HOH A:984binding site for residue SO4 A 604
5AC5SOFTWAREARG A:482 , HOH A:832binding site for residue SO4 A 605
6AC6SOFTWAREHIS A:375 , LYS A:420 , ILE A:458 , HOH A:719 , HOH A:953binding site for residue SO4 A 606
7AC7SOFTWARELEU A:398 , CYS A:484 , ARG A:485 , ARG A:488 , MET A:505 , SO4 A:603 , HOH A:711 , HOH A:799 , HOH A:814 , HOH A:824 , HOH A:873binding site for residue 8H8 A 607
8AC8SOFTWARELEU A:445 , GLU A:446 , ARG A:447 , ARG A:482 , THR A:547 , ARG A:548 , HOH A:899 , HOH A:959binding site for residue GOL A 608

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WH7)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Tyr A:497 -Pro A:498
2Glu A:524 -Pro A:525

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WH7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WH7)

(-) Exons   (0, 0)

(no "Exon" information available for 4WH7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:178
                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........................eehhhhhhhhhh......eeeeeeee..hhhhhhh.ee...ee..hhhhhhhhhhh..........eeeeeee.....hhhhhhhhhhhhhhhhh..........eeee.hhhhhhhhhh...ee........hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wh7 A 374 DHRELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHSEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWA 551
                                   383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WH7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WH7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WH7)

(-) Gene Ontology  (27, 27)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    8H8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:524 - Pro A:525   [ RasMol ]  
    Tyr A:497 - Pro A:498   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wh7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MPIP2_HUMAN | P30305
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.48
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MPIP2_HUMAN | P30305
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MPIP2_HUMAN | P30305: 1cwr 1cws 1cwt 1qb0 1ym9 1ymd 1ymk 1yml 1ys0 2a2k 2ifd 2ifv 2uzq 3fqt 3fqu 4wh9

(-) Related Entries Specified in the PDB File

4wh9