4U89 - JenaLib

Title :   4'-PHOSPHOPANTETHEINYL TRANSFERASE PPTT FROM MYCOBACTERIUM TUBERCULOSIS

Authors :   A. Faille, L. Mourey, J. D. Pedelacq

Date :   01 Aug 14 (Deposition) - 26 Aug 15 (Release) - 02 Sep 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.40

Chains :   Asym./Biol. Unit : A

Keywords :   Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Faille, S. Gavalda, K. Rottier, L. Mourey, J. D. Pedelacq
X-Ray Structure Of The 4'-Phosphopantetheinyl Transferase Pptt From Mycobacterium Tuberculosis
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 15)

Sites (15, 15)

Asymmetric Unit (15, 15)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ARG A:48 , PHE A:52 , ARG A:56 , LYS A:75 , LYS A:78 , GLY A:79 , GLU A:80 , PRO A:81 , LEU A:91 , THR A:92 , HIS A:93 , ASP A:114 , ASN A:123 , GLY A:124 , LYS A:156 , GLU A:157 , TYR A:160 , LYS A:161 , PHE A:164 , TRP A:170 , LEU A:171 , GLY A:172 , PHE A:173 , HOH A:401 , HOH A:438 , HOH A:443 , HOH A:467 , HOH A:491 , HOH A:493 , HOH A:503 , HOH A:509 , HOH A:510 , HOH A:515 , HOH A:523	binding site for residue COA A 301
02	AC2	SOFTWARE	ASP A:137 , THR A:141 , THR A:179 , PHE A:180 , HOH A:513	binding site for residue NA A 302
03	AC3	SOFTWARE	HIS A:177 , THR A:179 , VAL A:192 , HOH A:431	binding site for residue NA A 303
04	AC4	SOFTWARE	PRO A:72 , LEU A:74 , CYS A:82 , HOH A:540 , HOH A:616	binding site for residue NA A 304
05	AC5	SOFTWARE	TYR A:25 , HOH A:543 , HOH A:650 , HOH A:666	binding site for residue NA A 305
06	AC6	SOFTWARE	CYS A:94 , ALA A:95 , HOH A:486 , HOH A:487	binding site for residue NA A 306
07	AC7	SOFTWARE	HOH A:417 , HOH A:534 , HOH A:556 , HOH A:571	binding site for residue NA A 307
08	AC8	SOFTWARE	TRP A:83 , GLY A:89 , PRO A:165 , HOH A:500 , HOH A:507 , HOH A:663	binding site for residue NA A 308
09	AC9	SOFTWARE	PRO A:143 , PG4 A:314	binding site for residue NA A 309
10	AD1	SOFTWARE	PRO A:35 , HOH A:403 , HOH A:456 , HOH A:484	binding site for residue NA A 310
11	AD2	SOFTWARE	GLU A:17 , PRO A:33 , PRO A:35 , HOH A:435 , HOH A:444	binding site for residue NA A 311
12	AD3	SOFTWARE	HOH A:419 , HOH A:519 , HOH A:539	binding site for residue NA A 312
13	AD4	SOFTWARE	SER A:44 , ARG A:48 , HOH A:464 , HOH A:512 , HOH A:532 , HOH A:561 , HOH A:619	binding site for residue PO4 A 313
14	AD5	SOFTWARE	ALA A:42 , ARG A:49 , ARG A:140 , MET A:142 , ASP A:183 , SER A:184 , GLY A:186 , NA A:309	binding site for residue PG4 A 314
15	AD6	SOFTWARE	TRP A:170	binding site for residue IMD A 315

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh...hhh.eeeeee............hhhhhh..hhhhhhhhhhhhhhhhhhhhhh.........hhhhh......eeeeeeee..eeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhh.eeeeeee.....eeeeeeee.............eeeeeeeee..eeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4u89 A   3 VGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		IMD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PG4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4u89)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4u89
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	O33336_MYCTU \| O33336
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	O33336_MYCTU \| O33336
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description