Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF N-TERMINAL C1 DOMAIN OF KAIC
 
Authors :  J. Abe, T. B. Hiyama, A. Mukaiyama, S. Son, S. Akiyama
Date :  29 May 14  (Deposition) - 01 Jul 15  (Release) - 05 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Serine/Threonine-Protein Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Abe, T. B. Hiyama, A. Mukaiyama, S. Son, T. Mori, S. Saito, M. Osako, J. Wolanin, E. Yamashita, T. Kondo, S. Akiyama
Circadian Rhythms. Atomic-Scale Origins Of Slowness In The Cyanobacterial Circadian Clock.
Science V. 349 312 2015
PubMed-ID: 26113637  |  Reference-DOI: 10.1126/SCIENCE.1261040

(-) Compounds

Molecule 1 - CIRCADIAN CLOCK PROTEIN KINASE KAIC
    Chains: A, B, C, D, E, F
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1-253
    Gene: KAIC, SYNPCC7942_1216, SEE0011
    Mutation: YES
    Organism Scientific: SYNECHOCOCCUS ELONGATUS PCC 7942
    Organism Taxid: 1140
    Strain: PCC 7942
    Synonym: A4D_1

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 18)

Asymmetric/Biological Unit (4, 18)
No.NameCountTypeFull Name
1ADP4Ligand/IonADENOSINE-5'-DIPHOSPHATE
2ANP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
3CL6Ligand/IonCHLORIDE ION
4MG6Ligand/IonMAGNESIUM ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETHR A:48 , GLY A:49 , THR A:50 , GLY A:51 , LYS A:52 , THR A:53 , LEU A:54 , SER A:89 , PHE A:90 , ARG A:218 , ILE A:239 , THR A:240 , ASP A:241 , MG A:302 , HOH A:408 , HOH A:412 , HOH A:422 , HOH A:451 , HOH A:453 , HOH A:454 , PHE B:199 , LYS B:224 , LEU B:225 , ARG B:226 , THR B:228 , SER B:229 , HIS B:230binding site for residue ANP A 301
02AC2SOFTWARETHR A:53 , ASP A:145 , ANP A:301 , HOH A:451 , HOH A:452 , HOH A:453binding site for residue MG A 302
03AC3SOFTWAREARG A:218 , ILE A:239binding site for residue CL A 303
04AC4SOFTWAREGLY B:49 , THR B:50 , GLY B:51 , LYS B:52 , THR B:53 , LEU B:54 , SER B:89 , PHE B:90 , ARG B:218 , ILE B:239 , THR B:240 , ASP B:241 , MG B:302 , HOH B:423 , HOH B:476 , HOH B:503 , HOH B:504 , LYS C:224 , LEU C:225 , THR C:228 , SER C:229 , HIS C:230 , HOH C:422binding site for residue ADP B 301
05AC5SOFTWARETHR B:53 , ADP B:301 , HOH B:503 , HOH B:504 , HOH B:505 , HOH B:506binding site for residue MG B 302
06AC6SOFTWAREARG B:218 , ILE B:239 , HOH B:515binding site for residue CL B 303
07AC7SOFTWAREGLY C:49 , THR C:50 , GLY C:51 , LYS C:52 , THR C:53 , LEU C:54 , SER C:89 , PHE C:90 , ARG C:218 , ILE C:239 , ASP C:241 , MG C:302 , HOH C:421 , HOH C:432 , HOH C:453 , HOH C:495 , HOH C:508 , LYS D:224 , LEU D:225 , THR D:228 , SER D:229 , HIS D:230 , HOH D:440 , HOH D:539binding site for residue ADP C 301
08AC8SOFTWARETHR C:53 , ADP C:301 , HOH C:493 , HOH C:494 , HOH C:495 , HOH D:539binding site for residue MG C 302
09AC9SOFTWAREARG C:218 , THR C:238 , ILE C:239 , LYS D:232binding site for residue CL C 303
10AD1SOFTWAREGLY D:49 , THR D:50 , GLY D:51 , LYS D:52 , THR D:53 , LEU D:54 , SER D:89 , PHE D:90 , ARG D:218 , ILE D:239 , THR D:240 , ASP D:241 , MG D:302 , HOH D:429 , HOH D:462 , HOH D:517 , HOH D:536 , HOH D:537 , HOH D:538 , HOH D:546 , LYS E:224 , LEU E:225 , THR E:228 , SER E:229 , HIS E:230 , HOH E:425 , HOH E:444 , HOH E:525binding site for residue ADP D 301
11AD2SOFTWARETHR D:53 , ADP D:301 , HOH D:535 , HOH D:536 , HOH D:537 , HOH D:538binding site for residue MG D 302
12AD3SOFTWAREARG D:218 , ILE D:239 , HOH D:540binding site for residue CL D 303
13AD4SOFTWAREGLY E:49 , THR E:50 , GLY E:51 , LYS E:52 , THR E:53 , LEU E:54 , SER E:89 , PHE E:90 , ARG E:218 , ILE E:239 , MG E:302 , HOH E:434 , HOH E:441 , HOH E:502 , HOH E:521 , LYS F:224 , LEU F:225 , THR F:228 , SER F:229 , HIS F:230 , HOH F:430binding site for residue ADP E 301
14AD5SOFTWARETHR E:53 , ADP E:301 , HOH E:519 , HOH E:520 , HOH E:521 , HOH E:522binding site for residue MG E 302
15AD6SOFTWAREARG E:218 , THR E:238 , ILE E:239 , HOH E:494 , LYS F:232binding site for residue CL E 303
16AD7SOFTWARELYS A:224 , LEU A:225 , ARG A:226 , THR A:228 , SER A:229 , HIS A:230 , LYS A:232 , HOH A:406 , THR F:48 , GLY F:49 , THR F:50 , GLY F:51 , LYS F:52 , THR F:53 , LEU F:54 , SER F:89 , PHE F:90 , ARG F:218 , ILE F:239 , THR F:240 , ASP F:241 , MG F:302 , HOH F:427 , HOH F:494 , HOH F:504 , HOH F:518 , HOH F:519 , HOH F:520 , HOH F:531binding site for residue ANP F 301
17AD8SOFTWARETHR F:53 , ANP F:301 , HOH F:518 , HOH F:519 , HOH F:520binding site for residue MG F 302
18AD9SOFTWAREARG F:218 , ILE F:239 , HOH F:474binding site for residue CL F 303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TLA)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asp A:145 -Ser A:146
2Asp B:145 -Ser B:146

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TLA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TLA)

(-) Exons   (0, 0)

(no "Exon" information available for 4TLA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tla A  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP 248
                                    25        35        45        55        65        75        85        95       105       123       133       143  ||   162       172       182       192       202       212       222       232       242      
                                                                                                                           113|                     146|                                                                                            
                                                                                                                            122                      156                                                                                            


Chain B from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee...hhhhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee......hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tla B  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP 248
                                    25        35        45        55        65        75        85        95       105      |124       134       144 ||    162       172       182       192       202       212       222       232       242      
                                                                                                                          112|                     146|                                                                                             
                                                                                                                           122                      155                                                                                             


Chain C from PDB  Type:PROTEIN  Length:227
                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhhh...eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhhh.eeeeeee........hhhhhhhh...eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tla C  14 EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP 248
                                    23        33        43        53        63        73        83        93       103       113|      131       141       151       161       171       181       191       201       211       221       231       241       
                                                                                                                             113|                                                                                                                              
                                                                                                                              122                                                                                                                              


Chain D from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhh...eeeeehhhhhh....hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tla D  13 SEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPELSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLG 250
                                    22        32        42        52        62        72        82        92       102       112||     131       141       151       161       171       181       191       201       211       221       231       241         
                                                                                                                              113|                                                                                                                               
                                                                                                                               123                                                                                                                               


Chain E from PDB  Type:PROTEIN  Length:236
                                                                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee............hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhhh.eeeeeee........hhhhhhhh...eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tla E  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGA 251
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245      


Chain F from PDB  Type:PROTEIN  Length:224
                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhhh..eeeeehhhhhh....hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhh..eeeeeeeeee..eeeeeeeeee.........eeeeeee..eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tla F  17 AIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPELSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL 249
                                    26        36        46        56        66        76        86        96       106      |125       135       145       155       165       175       185       195       205       215       225       235       245    
                                                                                                                          113|                                                                                                                              
                                                                                                                           123
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TLA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TLA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TLA)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ANP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:145 - Ser A:146   [ RasMol ]  
    Asp B:145 - Ser B:146   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tla
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAIC_SYNE7 | Q79PF4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KAIC_SYNE7 | Q79PF4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAIC_SYNE7 | Q79PF4: 1tf7 1u9i 2gbl 3dvl 3jzm 3k09 3k0a 3k0c 3k0e 3k0f 3s1a 4dug 4ijm 4tl6 4tl7 4tl8 4tl9 4tlb 4tlc 4tld 4tle 5c5e 5n8y

(-) Related Entries Specified in the PDB File

4tl6 4tl7 4tl8 4tl9 4tlb 4tlc 4tld 4tle