Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF N-TERMINAL C1 DOMAIN OF KAIC
 
Authors :  J. Abe, T. B. Hiyama, A. Mukaiyama, S. Son, S. Akiyama
Date :  29 May 14  (Deposition) - 01 Jul 15  (Release) - 05 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Serine/Threonine-Protein Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Abe, T. B. Hiyama, A. Mukaiyama, S. Son, T. Mori, S. Saito, M. Osako, J. Wolanin, E. Yamashita, T. Kondo, S. Akiyama
Circadian Rhythms. Atomic-Scale Origins Of Slowness In The Cyanobacterial Circadian Clock.
Science V. 349 312 2015
PubMed-ID: 26113637  |  Reference-DOI: 10.1126/SCIENCE.1261040

(-) Compounds

Molecule 1 - CIRCADIAN CLOCK PROTEIN KINASE KAIC
    Chains: A, B, C, D, E, F
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 1-253
    Gene: KAIC, SYNPCC7942_1216, SEE0011
    Organism Scientific: SYNECHOCOCCUS ELONGATUS (STRAIN PCC 7942)
    Organism Taxid: 1140
    Strain: PCC 7942

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 24)

Asymmetric/Biological Unit (4, 24)
No.NameCountTypeFull Name
1ATP6Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2CL6Ligand/IonCHLORIDE ION
3MG6Ligand/IonMAGNESIUM ION
4SO46Ligand/IonSULFATE ION

(-) Sites  (24, 24)

Asymmetric Unit (24, 24)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:48 , GLY A:49 , THR A:50 , GLY A:51 , LYS A:52 , THR A:53 , LEU A:54 , SER A:89 , PHE A:90 , ARG A:218 , ILE A:239 , THR A:240 , ASP A:241 , MG A:302 , HOH A:424 , HOH A:432 , HOH A:458 , HOH A:497 , HOH A:498 , HOH A:499 , PHE B:199 , LYS B:224 , LEU B:225 , ARG B:226 , THR B:228 , HIS B:230 , HOH B:426 , HOH B:446binding site for residue ATP A 301
02AC2SOFTWARETHR A:53 , ATP A:301 , HOH A:497 , HOH A:498 , HOH A:499binding site for residue MG A 302
03AC3SOFTWAREARG A:218 , THR A:238 , ILE A:239binding site for residue CL A 303
04AC4SOFTWAREGLU A:186 , GLU A:187 , TYR A:188 , HOH A:471binding site for residue SO4 A 304
05AC5SOFTWARESER B:48 , GLY B:49 , THR B:50 , GLY B:51 , LYS B:52 , THR B:53 , LEU B:54 , SER B:89 , PHE B:90 , ARG B:218 , ILE B:239 , THR B:240 , ASP B:241 , MG B:302 , HOH B:423 , HOH B:447 , HOH B:467 , HOH B:493 , HOH B:494 , HOH B:495 , PHE C:199 , LYS C:224 , LEU C:225 , ARG C:226 , THR C:228 , HIS C:230 , HOH C:421binding site for residue ATP B 301
06AC6SOFTWARETHR B:53 , ATP B:301 , HOH B:493 , HOH B:494 , HOH B:495binding site for residue MG B 302
07AC7SOFTWAREARG B:218 , THR B:238 , ILE B:239binding site for residue CL B 303
08AC8SOFTWAREGLU B:186 , GLU B:187 , TYR B:188 , HOH B:485 , HOH B:504binding site for residue SO4 B 304
09AC9SOFTWARESER C:48 , GLY C:49 , THR C:50 , GLY C:51 , LYS C:52 , THR C:53 , LEU C:54 , SER C:89 , PHE C:90 , ARG C:218 , ILE C:239 , ASP C:241 , MG C:302 , HOH C:418 , HOH C:438 , HOH C:500 , HOH C:501 , HOH C:519 , HOH C:521 , HOH C:523 , PHE D:199 , LYS D:224 , LEU D:225 , ARG D:226 , THR D:228 , HIS D:230 , HOH D:434binding site for residue ATP C 301
10AD1SOFTWARETHR C:53 , ATP C:301 , HOH C:500 , HOH C:501 , HOH C:502binding site for residue MG C 302
11AD2SOFTWAREARG C:218 , THR C:238 , ILE C:239binding site for residue CL C 303
12AD3SOFTWAREGLU C:186 , GLU C:187 , TYR C:188 , HOH C:490binding site for residue SO4 C 304
13AD4SOFTWARESER D:48 , GLY D:49 , THR D:50 , GLY D:51 , LYS D:52 , THR D:53 , LEU D:54 , SER D:89 , PHE D:90 , ARG D:218 , ILE D:239 , THR D:240 , ASP D:241 , MG D:302 , HOH D:433 , HOH D:452 , HOH D:514 , HOH D:515 , HOH D:516 , HOH D:543 , PHE E:199 , LYS E:224 , LEU E:225 , ARG E:226 , THR E:228 , HIS E:230 , HOH E:424binding site for residue ATP D 301
14AD5SOFTWARETHR D:53 , ATP D:301 , HOH D:514 , HOH D:515 , HOH D:516binding site for residue MG D 302
15AD6SOFTWAREARG D:218 , THR D:238 , ILE D:239binding site for residue CL D 303
16AD7SOFTWAREGLU D:186 , GLU D:187 , TYR D:188 , HOH D:483binding site for residue SO4 D 304
17AD8SOFTWARESER E:48 , GLY E:49 , THR E:50 , GLY E:51 , LYS E:52 , THR E:53 , LEU E:54 , SER E:89 , PHE E:90 , ARG E:218 , ILE E:239 , THR E:240 , ASP E:241 , MG E:302 , HOH E:425 , HOH E:443 , HOH E:501 , HOH E:502 , HOH E:503 , PHE F:199 , LYS F:224 , LEU F:225 , ARG F:226 , THR F:228 , HIS F:230 , HOH F:405 , HOH F:406binding site for residue ATP E 301
18AD9SOFTWARETHR E:53 , ATP E:301 , HOH E:501 , HOH E:502 , HOH E:503binding site for residue MG E 302
19AE1SOFTWAREARG E:218 , ILE E:239binding site for residue CL E 303
20AE2SOFTWAREGLU E:186 , GLU E:187 , TYR E:188 , HOH E:449 , HOH E:484binding site for residue SO4 E 304
21AE3SOFTWAREPHE A:199 , LYS A:224 , LEU A:225 , ARG A:226 , THR A:228 , HIS A:230 , HOH A:428 , SER F:48 , GLY F:49 , THR F:50 , GLY F:51 , LYS F:52 , THR F:53 , LEU F:54 , SER F:89 , PHE F:90 , ARG F:218 , ILE F:239 , ASP F:241 , MG F:302 , HOH F:408 , HOH F:424 , HOH F:486 , HOH F:487 , HOH F:488binding site for residue ATP F 301
22AE4SOFTWARETHR F:53 , ATP F:301 , HOH F:486 , HOH F:487 , HOH F:488binding site for residue MG F 302
23AE5SOFTWAREARG F:218 , ILE F:239binding site for residue CL F 303
24AE6SOFTWAREGLU F:186 , GLU F:187 , TYR F:188binding site for residue SO4 F 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TL7)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Asp A:145 -Ser A:146
2Asp B:145 -Ser B:146
3Asp C:145 -Ser C:146
4Asp D:145 -Ser D:146
5Asp E:145 -Ser E:146
6Asp F:145 -Ser F:146

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TL7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TL7)

(-) Exons   (0, 0)

(no "Exon" information available for 4TL7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee......hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl7 A  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL 249
                                    25        35        45        55        65        75        85        95       105     ||124       134       144       154       164       174       184       194       204       214       224       234       244     
                                                                                                                         111|                                                                                                                                
                                                                                                                          121                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee......hhhhhhhhhhhhhhhh..eeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl7 B  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL 249
                                    25        35        45        55        65        75        85        95       105     ||124       134       144       154       164       174       184       194       204       214       224       234       244     
                                                                                                                         111|                                                                                                                                
                                                                                                                          121                                                                                                                                


Chain C from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee......hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl7 C  17 AIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLG 250
                                    26        36        46        56        66        76        86        96       106    || 125       135       145       155       165       175       185       195       205       215       225       235       245     
                                                                                                                        111|                                                                                                                                 
                                                                                                                         121                                                                                                                                 


Chain D from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhhhh..eeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl7 D  17 AIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLG 250
                                    26        36        46        56        66        76        86        96       106    || 124       134       144       154       164       174       184       194       204       214       224       234       244      
                                                                                                                        111|                                                                                                                                  
                                                                                                                         120                                                                                                                                  


Chain E from PDB  Type:PROTEIN  Length:227
                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee.......hhhhhhhhhhhhhhh...eeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl7 E  16 QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLG 250
                                    25        35        45        55        65        75        85        95       105     ||123       133       143       153       163       173       183       193       203       213       223       233       243       
                                                                                                                         111|                                                                                                                                  
                                                                                                                          120                                                                                                                                  


Chain F from PDB  Type:PROTEIN  Length:228
                                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......ee.....hhhhhh...ee...eeeeee....hhhhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhh.hhhhhhhh..eeeee......hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee............hhhhhh.eeeeeeeeee..eeeeeeeeeee........eeeeeee..eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tl7 F  14 EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLG 250
                                    23        33        43        53        63        73        83        93       103      |122       132       142       152       162       172       182       192       202       212       222       232       242        
                                                                                                                          110|                                                                                                                                  
                                                                                                                           120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TL7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TL7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TL7)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:145 - Ser A:146   [ RasMol ]  
    Asp B:145 - Ser B:146   [ RasMol ]  
    Asp C:145 - Ser C:146   [ RasMol ]  
    Asp D:145 - Ser D:146   [ RasMol ]  
    Asp E:145 - Ser E:146   [ RasMol ]  
    Asp F:145 - Ser F:146   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tl7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAIC_SYNE7 | Q79PF4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KAIC_SYNE7 | Q79PF4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAIC_SYNE7 | Q79PF4: 1tf7 1u9i 2gbl 3dvl 3jzm 3k09 3k0a 3k0c 3k0e 3k0f 3s1a 4dug 4ijm 4tl6 4tl8 4tl9 4tla 4tlb 4tlc 4tld 4tle 5c5e 5n8y

(-) Related Entries Specified in the PDB File

4tl6 4tl8 4tl9 4tla 4tlb 4tlc 4tld 4tle