Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HIS 92 ALA MUTATION IN RIBONUCLEASE T1 INDUCES SEGMENTAL FLEXIBILITY. AN X-RAY STUDY
 
Authors :  W. Saenger, G. Koellner
Date :  13 Feb 90  (Deposition) - 15 Jan 92  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Hydrolase(Endoribonuclease) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Koellner, H. W. Choe, U. Heinemann, H. P. Grunert, A. Zouni, U. Hahn, W. Saenger
His92Ala Mutation In Ribonuclease T1 Induces Segmental Flexibility. An X-Ray Study.
J. Mol. Biol. V. 224 701 1992
PubMed-ID: 1314902  |  Reference-DOI: 10.1016/0022-2836(92)90554-W
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIBONUCLEASE T1
    Chains: A
    EC Number: 3.1.27.3
    Engineered: YES
    Organism Scientific: ASPERGILLUS ORYZAE
    Organism Taxid: 5062

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4RNT)

(-) Sites  (0, 0)

(no "Site" information available for 4RNT)

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:2 -A:10
2A:6 -A:103

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Tyr A:38 -Pro A:39
2Ser A:54 -Pro A:55

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4RNT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4RNT)

(-) Exons   (0, 0)

(no "Exon" information available for 4RNT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:104
                                                                                                                                        
               SCOP domains d4rnta_ A: RNase T1                                                                                      SCOP domains
               CATH domains 4rntA00 A:1-104  [code=3.10.450.30, no name defined]                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeeehhhhhhhhhhhhhhhhh.........eeee............eeeeeeee.............eeeeee...eeeeeee........eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 4rnt A   1 ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITATGASGNNFVECT 104
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4RNT)

(-) Gene Ontology  (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4rnt)
 
  Sites
(no "Sites" information available for 4rnt)
 
  Cis Peptide Bonds
    Ser A:54 - Pro A:55   [ RasMol ]  
    Tyr A:38 - Pro A:39   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4rnt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RNT1_ASPOR | P00651
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.27.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RNT1_ASPOR | P00651
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RNT1_ASPOR | P00651: 1b2m 1bir 1bu4 1bvi 1ch0 1det 1fys 1fzu 1g02 1gsp 1hyf 1hz1 1i0v 1i0x 1i2e 1i2f 1i2g 1i3f 1i3i 1iyy 1lov 1low 1loy 1lra 1q9e 1rga 1rgc 1rgk 1rgl 1rhl 1rls 1rn1 1rn4 1rnt 1trp 1trq 1tto 1ygw 2aad 2aae 2bir 2bu4 2gsp 2hoh 2rnt 3bir 3bu4 3gsp 3hoh 3rnt 3syu 3urp 4bir 4bu4 4gsp 4hoh 4odk 5bir 5bu4 5gsp 5hoh 5rnt 6gsp 6rnt 7gsp 7rnt 8rnt 9rnt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4RNT)