Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  LANDOMYCIN GLYCOSYLTRANSFERASE LANGT2, CARBASUGAR SUBSTRATE COMPLEX
 
Authors :  H. K. Tam, S. Gerhardt, B. Breit, A. Bechthold, O. Einsle
Date :  06 Oct 14  (Deposition) - 28 Jan 15  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gt Fold, Glycosyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. K. Tam, J. Harle, S. Gerhardt, J. Rohr, G. Wang, J. S. Thorson, A. Bigot, M. Lutterbeck, W. Seiche, B. Breit, A. Bechthold, O. Einsle
Structural Characterization Of O- And C-Glycosylating Variants Of The Landomycin Glycosyltransferase Langt2.
Angew. Chem. Int. Ed. Engl. V. 54 2811 2015
PubMed-ID: 25581707  |  Reference-DOI: 10.1002/ANIE.201409792

(-) Compounds

Molecule 1 - GLYCOSYL TRANSFERASE HOMOLOG
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: LANGT2
    Organism Scientific: STREPTOMYCES CYANOGENUS
    Organism Taxid: 80860
    Strain: S136

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
13R22Ligand/Ion2'-DEOXY-5'-O-[(R)-{[(R)-{[(1S,3R,4R,5S)-3,4-DIHYDROXY-5-METHYLCYCLOHEXYL]OXY}(HYDROXY)PHOSPHORYL]OXY}(HYDROXY)PHOSPHORYL]-3,4-DIHYDROTHYMIDINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:10 , ALA A:12 , PHE A:15 , TRP A:136 , ASP A:137 , ASN A:195 , GLY A:218 , SER A:219 , ARG A:220 , ALA A:247 , THR A:248 , TRP A:267 , VAL A:268 , LEU A:270 , HIS A:283 , GLY A:285 , GLY A:286 , VAL A:287 , THR A:288 , HOH A:516 , HOH A:574 , HOH A:593 , HOH A:594 , HOH A:605BINDING SITE FOR RESIDUE 3R2 A 401
2AC2SOFTWARESER B:10 , ALA B:12 , PHE B:15 , TRP B:136 , ASP B:137 , ASN B:195 , GLY B:218 , SER B:219 , ARG B:220 , ALA B:247 , THR B:248 , TRP B:267 , VAL B:268 , LEU B:270 , HIS B:283 , GLY B:285 , GLY B:286 , VAL B:287 , THR B:288 , HOH B:528 , HOH B:549BINDING SITE FOR RESIDUE 3R2 B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4RIF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4RIF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4RIF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4RIF)

(-) Exons   (0, 0)

(no "Exon" information available for 4RIF)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:370
                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhh....eeeeehhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhh.........eeee..hhhhh.......ee............hhhhhh.....eeeee...hhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhh...eee..hhhhhhhhh.eeee..hhhhhhhhhhh...eee......hhhhhhhhhhhh.eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4rif A   1 MKILFVASGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPALSIAPSSIRRYATMDREGEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVENLYFQ 379
                                    10        20        30        40        50        60       |79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379
                                                                                              68|                                                                                                                                                                                                                                                                                                             
                                                                                               78                                                                                                                                                                                                                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:379
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhh....eeeeehhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhh.........eeee..hhhhh.......ee............hhhhhh.....eeeee...hhhhhh.hhhhhhhhhhh.....eeeee.hhhhhhhhhhhh...eee..hhhhhhhhh.eeee..hhhhhhhhhhh...eee......hhhhhhhhhhhh.eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4rif B   1 MKILFVASGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPALSIAPSSIRRYATMDREGNPVRMPETPEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVENLYFQ 379
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4RIF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4RIF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4RIF)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3R2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4rif)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4rif
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9ZGC0_STRCY | Q9ZGC0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9ZGC0_STRCY | Q9ZGC0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9ZGC0_STRCY | Q9ZGC0: 4rie 4rig 4rih 4rii

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4RIF)