Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF ENGINEERED PYRR PROTEIN (PURPLE PYRR)
 
Authors :  T. Perica, Y. Kondo, S. Tiwari, S. Mclaughlin, A. Steward, N. Reuter, J. S. A. Teichmann
Date :  30 Mar 14  (Deposition) - 17 Dec 14  (Release) - 31 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Rna Binding Proteins, Reconstructed Amino Acid Sequence, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Perica, Y. Kondo, S. P. Tiwari, S. H. Mclaughlin, K. R. Kemplen, X. Zhang, A. Steward, N. Reuter, J. Clarke, S. A. Teichmann
Evolution Of Oligomeric State Through Allosteric Pathways That Mimic Ligand Binding.
Science V. 346 54346 2014
PubMed-ID: 25525255  |  Reference-DOI: 10.1126/SCIENCE.1254346

(-) Compounds

Molecule 1 - ENGINEERED PYRR PROTEIN (PURPLE)
    Chains: A, B, C, D
    Engineered: YES
    Expression System: BACTERIA
    Expression System Taxid: 629395
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1U5P4Ligand/IonURIDINE-5'-MONOPHOSPHATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:41 , ASP A:106 , ASP A:107 , VAL A:108 , PHE A:110 , THR A:111 , GLY A:112 , ARG A:113 , THR A:114 , ARG A:139 , ILE A:163 , HOH A:306 , HOH A:317binding site for residue U5P A 201
2AC2SOFTWARELYS B:41 , ASP B:106 , ASP B:107 , VAL B:108 , PHE B:110 , THR B:111 , GLY B:112 , ARG B:113 , THR B:114 , ARG B:139 , LEU B:162 , ILE B:163 , HOH B:305 , HOH B:317 , HOH B:325 , HOH B:326binding site for residue U5P B 201
3AC3SOFTWARELYS C:41 , ASP C:106 , ASP C:107 , VAL C:108 , PHE C:110 , THR C:111 , GLY C:112 , ARG C:113 , THR C:114 , ARG C:139 , LEU C:162 , ILE C:163 , HOH C:307 , HOH C:327binding site for residue U5P C 201
4AC4SOFTWARELYS D:41 , ARG D:43 , TYR D:73 , ARG D:74 , ASP D:106 , ASP D:107 , VAL D:108 , PHE D:110 , THR D:111 , GLY D:112 , ARG D:113 , THR D:114 , ARG D:139 , LEU D:162 , ILE D:163 , HOH D:304 , HOH D:306 , HOH D:310 , HOH D:314binding site for residue U5P D 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4P83)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4P83)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P83)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P83)

(-) Exons   (0, 0)

(no "Exon" information available for 4P83)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:165
                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeehhhhhhhhhhhhhhhhhhhhh....eeeeeehhhhhhhhhhhhhhhhhhhh....eeeeeee....eeeeee........eeeeeeeee..hhhhhhhhhhhhhhh...eeeeeeeee...........eeeee.......eeeeehhhhhh..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p83 A   5 KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHE 180
                                    14        24        34        44        54        64       |85        95       105       115       125       135       145       155       165       175     
                                                                                              72|                                                                                                
                                                                                               84                                                                                                


Chain B from PDB  Type:PROTEIN  Length:168
                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeehhhhhhhhhhhhhhhhhhhhh....eeeeeehhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeee........eeeeeeeee..hhhhhhhhhhhhhhh...eeeeeeeee...........eeeee......eeeeeehhhhhh..eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4p83 B   5 KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLYDDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHEN 181
                                    14        24        34        44        54        64        83        93       103       113       123       133       143       153       163       173        
                                                                                               73|                                                                                                  
                                                                                                83                                                                                                  


Chain C from PDB  Type:PROTEIN  Length:167
                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeehhhhhhhhhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhhh....eeeeeeeee...eeeeeeee........eeeeeeeee..hhhhhhhhhhhhhhh...eeeeeeeee...........eeeee......eeeeeehhhhhh..eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p83 C   5 KAVIMDEQAIRRALTRIAHEIIERNKDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLYRDDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHEN 181
                                    14        24     || 36        46        56        66        84        94       104       114       124       134       144       154       164       174       
                                                    30|                                        75|                                                                                                 
                                                     33                                         84                                                                                                 


Chain D from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeehhhhhhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhhhhhhhhhhhh....eeeeee...........eeeee........eeeeeeeee..hhhhhhhhhhhhhhh...eeeeeeeee...........eeeee.......eeeeehhhhhh..eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p83 D   5 KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLYRDDDDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHEN 181
                                    14        24        34        44        54        64        74||      90       100       110       120       130       140       150       160       170       180 
                                                                                                 75|                                                                                                   
                                                                                                  82
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P83)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P83)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P83)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4P83)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    U5P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4p83)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p83
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4P83)

(-) Related Entries Specified in the PDB File

4p80 4p81 4p82 4p84 4p86