Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF T877A-AR-LBD BOUND WITH CO-REGULATOR PEPTIDE
 
Authors :  J. S. Liu, C. L. Hsu, W. G. Wu
Date :  20 Jan 14  (Deposition) - 20 Aug 14  (Release) - 24 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.01
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Helix, Hormone/Growth Factor Receptor, Phosphorylation, Hormone Receptor-Peptide Complex, Signal Transduction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. L. Hsu, J. S. Liu, P. L. Wu, H. H. Guan, Y. L. Chen, A. C. Lin, H. J. Ting, S. T. Pang, S. D. Yeh, W. L. Ma, C. J. Chen, W. G. Wu, C. Chang
Identification Of A New Androgen Receptor (Ar) Co-Regulator Bud31 And Related Peptides To Suppress Wild-Type And Mutate Ar-Mediated Prostate Cancer Growth Via Peptide Screening An X-Ray Structure Analysis.
Mol Oncol V. 8 1575 2014
PubMed-ID: 25091737  |  Reference-DOI: 10.1016/J.MOLONC.2014.06.009

(-) Compounds

Molecule 1 - ANDROGEN RECEPTOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentLIGAND BINDING DOAMIN
    GeneAR, DHTR, NR3C4
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDIHYDROTESTOSTERONE RECEPTOR, NUCLEAR RECEPTOR SUBFAMILY 3 GROUP C MEMBER 4
 
Molecule 2 - CO-REGULATOR PEPTIDE
    ChainsB
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HFT1Ligand/IonHYDROXYFLUTAMIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:704 , ASN A:705 , LEU A:707 , GLY A:708 , GLN A:711 , MET A:745 , VAL A:746 , MET A:749 , ARG A:752 , PHE A:764 , MET A:895 , HOH A:1106BINDING SITE FOR RESIDUE HFT A 1001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4OIU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4OIU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4OIU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4OIU)

(-) Exons   (0, 0)

(no "Exon" information available for 4OIU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:242
                                                                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.....eehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..eee.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..eee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4oiu A 670 QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT 918
                                   679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839   ||  856       866       876       886       896       906       916  
                                                                                                                                                                                                       843|                                                                   
                                                                                                                                                                                                        851                                                                   

Chain B from PDB  Type:PROTEIN  Length:7
                                       
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author .hhhhhh Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 4oiu B   1 SSFRDWY   7

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4OIU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4OIU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4OIU)

(-) Gene Ontology  (55, 55)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HFT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4oiu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4oiu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANDR_HUMAN | P10275
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANDR_HUMAN | P10275
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANDR_HUMAN | P102751e3g 1gs4 1t5z 1t63 1t65 1xj7 1xow 1xq3 1z95 2am9 2ama 2amb 2ao6 2ax6 2ax7 2ax8 2ax9 2axa 2hvc 2oz7 2pio 2pip 2piq 2pir 2pit 2piu 2piv 2piw 2pix 2pkl 2pnu 2q7i 2q7j 2q7k 2q7l 2yhd 2ylo 2ylp 2ylq 2z4j 3b5r 3b65 3b66 3b67 3b68 3btr 3l3x 3l3z 3rlj 3rll 3v49 3v4a 3zqt 4hlw 4k7a 4oea 4oed 4oey 4oez 4ofr 4ofu 4ogh 4oh5 4oh6 4oha 4oil 4oj9 4ojb 4ok1 4okb 4okt 4okw 4okx 4olm 4ql8 5cj6 5jjm 5t8e 5t8j 5v8q

(-) Related Entries Specified in the PDB File

4oea 4oed 4oey 4oez 4ofr 4ofu 4ogh 4oh5 4oh6 4oha 4oil 4oj9 4ojb 4ok1 4okb 4okt 4okw 4okx 4olm