Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE HAEMOPHILUS INFLUENZAE HXUA SECRETION DOMAIN INVOLVED IN THE TWO-PARTNER SECRETION PATHWAY
 
Authors :  S. Baelen, F. Dewitte, B. Clantin, V. Villeret
Date :  03 Dec 12  (Deposition) - 13 Nov 13  (Release) - 18 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Beta-Helix, Two-Partner Secretion Pathway, Hxub, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Baelen, F. Dewitte, B. Clantin, V. Villeret
Structure Of The Secretion Domain Of Hxua From Haemophilus Influenzae.
Acta Crystallogr. , Sect. F V. 69 1322 2013
PubMed-ID: 24316822  |  Reference-DOI: 10.1107/S174430911302962X

(-) Compounds

Molecule 1 - HEME/HEMOPEXIN-BINDING PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)OMP5
    Expression System Taxid: 469008
    Fragment: UNP RESIDUES 24-324
    Gene: HI_0264, HXUA, KW20
    Organism Scientific: HAEMOPHILUS INFLUENZAE
    Organism Taxid: 71421
    Strain: ATCC 51907 / DSM 11121 / KW20 / RD

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4I84)

(-) Sites  (0, 0)

(no "Site" information available for 4I84)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4I84)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4I84)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4I84)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4I84)

(-) Exons   (0, 0)

(no "Exon" information available for 4I84)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:296
                                                                                                                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee..eeeeee..eeeeee...eeeeeeee.......eeeee......eeeeee.....eee..eeee..eeeee....eee....eee..eeeee................ee........eeee..eee...eeeee..eeee..eee.....eeeeee.eeeee....eeeee.hhhh....eeee..eeee.eeeeee.........eeee..eeee.ee..ee.eeeee..eeee....eeee..eeeee......eeeee....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4i84 A   1 RDLPQGSSVVVGEANVSTIGNKMTIDQKTPTTQIDWHSFDIGQNKEVEFKQPDANSVAYNRVTGGNASQIQGKLTANGKVYLANPNGVIITQGAEINVAGLFATTKDLERISENGNGNGNKFTRKVVKEGQVINKGKIKAKDFVVLNGDKVINEGEIDATNNGKVYLSSGYNFTFTLSDSSISVALEDNAVQSIVQNEGIIKAGDITLNAKGRNQALDSLVMNNGVLEATKVSNKNGKVVLSADDVQLNNKSDIKGESEVVFTNEPKNKIKITSQTGSKVTSPKINFTGKSVNING 301
                                    10        20        30        40        50        60        70        80        90       100       110       120    || 135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295      
                                                                                                                                                      125|                                                                                                                                                                          
                                                                                                                                                       131                                                                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee..eeeeee..eeeeee...eeeeeeee.......eeeee......eeeeee.....eee..eeee..eeeee....eee....eee..eeeee.................eeee..eee...eeeee..eeee..eee.....eeeeee.eee...eee.....eeee..eeee.eeeeee.....eeee..eeee.ee..ee.eeeee..eeee....eeee..eeeee......eeeee....eeeeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4i84 B   1 RDLPQGSSVVVGEANVSTIGNKMTIDQKTPTTQIDWHSFDIGQNKEVEFKQPDANSVAYNRVTGGNASQIQGKLTANGKVYLANPNGVIITQGAEINVAGLFATTKDLERISGNKFTRKLGQVINKGKIKAKDFVVLNGDKVINEGEIDATNNGKVYLSSGYNFTFSISVALVQSIVQNEGIIKAGDITLNAKALDSLVMNNGVLEATKVSNKNGKVVLSADDVQLNNKSDIKGESEVVFTNEPKNKIKITSQTGSKVTSPKINFTGKSVNING 301
                                    10        20        30        40        50        60        70        80        90       100       110 ||    126|      144       154       164       174     ||189 ||    203       213  ||   227       237       247       257       267       277       287       297    
                                                                                                                                         112|    126|                                          180|  191|                 216|                                                                                
                                                                                                                                          119     135                                           186   196                  221
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4I84)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4I84)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4I84)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4i84)
 
  Sites
(no "Sites" information available for 4i84)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4i84)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4i84
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HXUA1_HAEIN | P44602
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HXUA1_HAEIN | P44602
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HXUA1_HAEIN | P44602: 4rm6 4rt6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4I84)