|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 4DO2) |
(no "Site" information available for 4DO2) |
(no "SS Bond" information available for 4DO2) |
(no "Cis Peptide Bond" information available for 4DO2) |
(no "SAP(SNP)/Variant" information available for 4DO2) |
(no "PROSITE Motif" information available for 4DO2) |
(no "Exon" information available for 4DO2) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:57 aligned with ROP_ECOLX | P03051 from UniProtKB/Swiss-Prot Length:63 Alignment length:57 10 20 30 40 50 ROP_ECOLX 1 MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG 57 SCOP domains d4do2a_ A: ROP protein SCOP domains CATH domains --------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 4do2 A 1 MTKQEKTALNMARFIRSQTLTLLEKLNELPGDEQADICESLHDHADELYRSCLARFG 57 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:57 aligned with ROP_ECOLX | P03051 from UniProtKB/Swiss-Prot Length:63 Alignment length:57 10 20 30 40 50 ROP_ECOLX 1 MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG 57 SCOP domains d4do2b_ B: ROP protein SCOP domains CATH domains --------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 4do2 B 1 MTKQEKTALNMARFIRSQTLTLLEKLNELPGDEQADICESLHDHADELYRSCLARFG 57 10 20 30 40 50
|
Asymmetric/Biological Unit
|
(no "CATH Domain" information available for 4DO2) |
(no "Pfam Domain" information available for 4DO2) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (ROP_ECOLX | P03051)
|
|
|
|
|
|
|