![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1QX8) |
(no "Site" information available for 1QX8) |
(no "SS Bond" information available for 1QX8) |
(no "Cis Peptide Bond" information available for 1QX8) |
(no "SAP(SNP)/Variant" information available for 1QX8) |
(no "PROSITE Motif" information available for 1QX8) |
(no "Exon" information available for 1QX8) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:47 aligned with ROP_ECOLX | P03051 from UniProtKB/Swiss-Prot Length:63 Alignment length:52 14 24 34 44 54 ROP_ECOLX 5 EKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF 56 SCOP domains d1qx8a_ A: ROP protein SCOP domains CATH domains ---------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------- PROSITE Transcript ---------------------------------------------------- Transcript 1qx8 A 5 EKTALNMARFIRSQTLTLLEKLNEL-----ADICESLHDHADELYRSCLARF 51 14 24 | -| 39 49 29 30 Chain B from PDB Type:PROTEIN Length:51 aligned with ROP_ECOLX | P03051 from UniProtKB/Swiss-Prot Length:63 Alignment length:56 10 20 30 40 50 ROP_ECOLX 1 MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF 56 SCOP domains d1qx8b_ B: ROP protein SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains (1) Rop-1qx8B01 B:1-51 ----- Pfam domains (1) Pfam domains (2) Rop-1qx8B02 B:1-51 ----- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 1qx8 B 1 MTKQEKTALNMARFIRSQTLTLLEKLNEL-----ADICESLHDHADELYRSCLARF 51 10 20 |- | 35 45 29 30
|
Asymmetric Unit
|
(no "CATH Domain" information available for 1QX8) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (ROP_ECOLX | P03051)
|
|
|
|
|
|
|