Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE THIOREDOXIN REDUCTASE FROM ENTAMOEBA HISTOLYTICA
 
Authors :  L. M. Podust
Date :  25 Oct 11  (Deposition) - 31 Oct 12  (Release) - 06 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.66
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Oxidoreductase, Redox Metabolism, Oxidative Stress (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Parsonage, F. Sheng, K. Hirata, A. Debnath, J. H. Mckerrow, S. L. Reed, R. Abagyan, L. B. Poole, L. M. Podust
X-Ray Structures Of Thioredoxin And Thioredoxin Reductase From Entamoeba Histolytica And Prevailing Hypothesis Of The Mechanism Of Auranofin Action.
J. Struct. Biol. V. 194 180 2016
PubMed-ID: 26876147  |  Reference-DOI: 10.1016/J.JSB.2016.02.015

(-) Compounds

Molecule 1 - THIOREDOXIN REDUCTASE
    ChainsA, B
    EC Number1.8.1.9
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPTRCHISA
    Expression System StrainB834
    Expression System Taxid562
    Expression System VectorPTRCHIS
    Expression System Vector TypePLASMID
    Organism ScientificENTAMOEBA HISTOLYTICA
    Organism Taxid5759

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3SO41Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:160 , GLY A:161 , ASP A:162 , ALA A:163 , HIS A:182 , ARG A:183 , ARG A:184 , ARG A:188 , ALA A:245 , ILE A:246 , SO4 A:1316 , HOH A:2188 , HOH A:2189 , HOH A:2193 , HOH A:2194 , HOH A:2196 , HOH A:2230 , HOH A:2293 , HOH A:2294 , HOH A:2295 , HOH A:2296BINDING SITE FOR RESIDUE NDP A1315
2AC2SOFTWAREARG A:183 , NDP A:1315 , ARG B:183 , NDP B:1315BINDING SITE FOR RESIDUE SO4 A1316
3AC3SOFTWAREILE A:10 , GLY A:11 , SER A:12 , GLY A:13 , PRO A:14 , ALA A:15 , TYR A:33 , GLU A:34 , GLY A:35 , ALA A:38 , VAL A:41 , ALA A:42 , GLY A:45 , GLN A:46 , LEU A:47 , THR A:50 , ILE A:53 , ASN A:55 , THR A:87 , ILE A:88 , ALA A:116 , THR A:117 , GLY A:118 , ALA A:119 , HIS A:248 , GLY A:283 , ASP A:284 , ARG A:291 , GLN A:292 , ALA A:293 , ALA A:296 , HOH A:2011 , HOH A:2030 , HOH A:2046 , HOH A:2056 , HOH A:2060 , HOH A:2157 , HOH A:2158 , HOH A:2298 , TYR B:22BINDING SITE FOR RESIDUE FAD A1317
4AC4SOFTWARESO4 A:1316 , LYS B:122 , GLY B:160 , GLY B:161 , ASP B:162 , ALA B:163 , HIS B:182 , ARG B:183 , ARG B:184 , ARG B:188 , ALA B:245 , ILE B:246 , HIS B:248 , ARG B:291 , HOH B:2137 , HOH B:2169 , HOH B:2170 , HOH B:2182 , HOH B:2183 , HOH B:2185 , HOH B:2246 , HOH B:2308 , HOH B:2310BINDING SITE FOR RESIDUE NDP B1315
5AC5SOFTWARETYR A:22 , HOH A:2018 , ILE B:10 , GLY B:11 , SER B:12 , GLY B:13 , PRO B:14 , ALA B:15 , TYR B:33 , GLU B:34 , GLY B:35 , ALA B:38 , VAL B:41 , ALA B:42 , GLY B:45 , GLN B:46 , LEU B:47 , THR B:50 , ILE B:53 , ASN B:55 , ILE B:88 , THR B:117 , GLY B:118 , ALA B:119 , GLY B:283 , ASP B:284 , ARG B:291 , GLN B:292 , ALA B:293 , ALA B:296 , HOH B:2008 , HOH B:2026 , HOH B:2045 , HOH B:2053 , HOH B:2058 , HOH B:2129 , HOH B:2130 , HOH B:2251BINDING SITE FOR RESIDUE FAD B1316

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:140 -A:143
2B:140 -B:143

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gln A:96 -Pro A:97
2Gln B:96 -Pro B:97

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4A5L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4A5L)

(-) Exons   (0, 0)

(no "Exon" information available for 4A5L)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:313
 aligned with C4LW95_ENTHI | C4LW95 from UniProtKB/TrEMBL  Length:314

    Alignment length:313
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311   
         C4LW95_ENTHI     2 SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..hhhhhhhhhhhhhh....eee...hhhhh...hhhhhh.ee.........eehhhhhhhhhhhhhhh..eee...eeeee.....eeeee....eeeeeeeee...eee......hhhhhh...ee.hhhhhh.hhhhh..eeeee..hhhhhhhhhhhh....eeeee........hhhhhhhhhh...eeee..eeeeeeee....eeeeeeee.....eeeee..eeee...eee.hhhhh......................eee..........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4a5l A   2 SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311   

Chain B from PDB  Type:PROTEIN  Length:312
 aligned with C4LW95_ENTHI | C4LW95 from UniProtKB/TrEMBL  Length:314

    Alignment length:312
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312  
         C4LW95_ENTHI     3 NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..hhhhhhhhhhhhhh....eee...hhhhh...hhhhhh.ee.........eehhhhhhhhhhhhhhh..eee...eeeee.....eeeee....eeeeeeeee...eee......hhhhhh...ee.hhhhhh.hhhhh..eeeee..hhhhhhhhhhhh....eeeee........hhhhhhhhhh...eeee..eeeeeeee....eeeeeeee.....eeeee..eeee...eee.hhhhh......................eee.hhhh.....hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4a5l B   3 NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4A5L)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4A5L)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4A5L)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (C4LW95_ENTHI | C4LW95)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004791    thioredoxin-disulfide reductase activity    Catalysis of the reaction: NADP(+) + thioredoxin = H(+) + NADPH + thioredoxin disulfide.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0019430    removal of superoxide radicals    Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:96 - Pro A:97   [ RasMol ]  
    Gln B:96 - Pro B:97   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4a5l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C4LW95_ENTHI | C4LW95
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.8.1.9
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  C4LW95_ENTHI | C4LW95
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        C4LW95_ENTHI | C4LW954a65 4cbq 4ccq 4ccr 4up3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4A5L)