Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE MUTANT C140S,C286Q THIOREDOXIN REDUCTASE FROM ENTAMOEBA HISTOLYTICA
 
Authors :  L. M. Podust, D. F. Vieira
Date :  11 Jun 14  (Deposition) - 01 Jul 15  (Release) - 06 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.44
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Oxidoreductase, Redox Metabolism, Oxidative Stress (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Parsonage, F. Sheng, K. Hirata, A. Debnath, J. H. Mckerrow, S. L. Reed, R. Abagyan, L. B. Poole, L. M. Podust
X-Ray Structures Of Thioredoxin And Thioredoxin Reductase From Entamoeba Histolytica And Prevailing Hypothesis Of The Mechanism Of Auranofin Action.
J. Struct. Biol. V. 194 180 2016
PubMed-ID: 26876147  |  Reference-DOI: 10.1016/J.JSB.2016.02.015

(-) Compounds

Molecule 1 - THIOREDOXIN REDUCTASE
    Chains: A, B
    EC Number: 1.8.1.9
    Engineered: YES
    Expression System: ESCHERICHIA COLI B
    Expression System Plasmid: PTRCHISA
    Expression System Strain: B834
    Expression System Taxid: 37762
    Expression System Vector: PTRCHIS
    Mutation: YES
    Organism Scientific: ENTAMOEBA HISTOLYTICA
    Organism Taxid: 5759

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1EDO1Ligand/Ion1,2-ETHANEDIOL
2FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:10 , GLY A:11 , SER A:12 , GLY A:13 , PRO A:14 , ALA A:15 , TYR A:33 , GLU A:34 , GLY A:35 , ALA A:38 , VAL A:41 , ALA A:42 , ALA A:43 , GLY A:45 , GLN A:46 , LEU A:47 , THR A:49 , THR A:50 , ILE A:53 , ASN A:55 , THR A:87 , ILE A:88 , ALA A:116 , THR A:117 , GLY A:118 , ALA A:119 , HIS A:248 , GLY A:283 , ASP A:284 , ARG A:291 , GLN A:292 , ALA A:293 , ALA A:296 , NDP A:1316 , HOH A:2015 , HOH A:2038 , HOH A:2064 , HOH A:2070 , HOH A:2074 , HOH A:2079 , HOH A:2193 , HOH A:2194 , HOH A:2413 , TYR B:22BINDING SITE FOR RESIDUE FAD A1315
2AC2SOFTWARETYR A:22 , HOH A:2025 , ILE B:10 , GLY B:11 , SER B:12 , GLY B:13 , PRO B:14 , ALA B:15 , TYR B:33 , GLU B:34 , GLY B:35 , ALA B:38 , VAL B:41 , ALA B:42 , ALA B:43 , GLY B:45 , GLN B:46 , LEU B:47 , THR B:50 , ILE B:53 , ASN B:55 , THR B:87 , ILE B:88 , ALA B:116 , THR B:117 , GLY B:118 , ALA B:119 , GLY B:283 , ASP B:284 , ARG B:291 , GLN B:292 , ALA B:293 , ALA B:296 , HOH B:2016 , HOH B:2038 , HOH B:2051 , HOH B:2057 , HOH B:2061 , HOH B:2139 , HOH B:2140 , HOH B:2345BINDING SITE FOR RESIDUE FAD B1315
3AC3SOFTWAREGLY A:160 , GLY A:161 , ASP A:162 , ALA A:163 , GLU A:166 , HIS A:182 , ARG A:183 , ARG A:184 , ARG A:188 , ALA A:245 , ILE A:246 , FAD A:1315 , HOH A:2199 , HOH A:2208 , HOH A:2238 , HOH A:2239 , HOH A:2240 , HOH A:2250 , HOH A:2259 , HOH A:2261 , HOH A:2324 , HOH A:2325 , HOH A:2414 , HOH A:2415 , HOH A:2416 , HOH A:2417 , ARG B:183BINDING SITE FOR RESIDUE NDP A1316
4AC4SOFTWARELYS B:122 , GLY B:160 , GLY B:161 , ASP B:162 , ALA B:163 , GLU B:166 , HIS B:182 , ARG B:183 , ARG B:184 , ARG B:188 , ALA B:245 , ILE B:246 , HIS B:248 , TYR B:290 , ARG B:291 , GLN B:292 , HOH B:2146 , HOH B:2178 , HOH B:2179 , HOH B:2180 , HOH B:2189 , HOH B:2190 , HOH B:2193 , HOH B:2206 , HOH B:2207 , HOH B:2265 , HOH B:2269 , HOH B:2324 , HOH B:2344 , HOH B:2346 , HOH B:2347 , HOH B:2348 , HOH B:2349BINDING SITE FOR RESIDUE NDP B1316
5AC5SOFTWARELEU B:268 , SER B:275 , HOH B:2350BINDING SITE FOR RESIDUE EDO B1317

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4UP3)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gln A:96 -Pro A:97
2Gln B:96 -Pro B:97

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4UP3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4UP3)

(-) Exons   (0, 0)

(no "Exon" information available for 4UP3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:312
                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..hhhhhhhhhhhhhh....eee...hhhhh...hhhhhh.ee.........eehhhhhhhhhhhhhhh..eee...eeeee.....eeeee....eeeeeeeee...eee......hhhhhh...ee.hhhhhh.hhhhh..eeeee..hhhhhhhhhhhh....eeeee........hhhhhhhhhh...eeee..eeeeeeee....eeeeeeee.....eeeee..eeee...eee.hhhhh......................eee.hhhhh....hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4up3 A   3 NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSASAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVQDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312  


Chain B from PDB  Type:PROTEIN  Length:312
                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..hhhhhhhhhhhhhh....eee...hhhhh...hhhhhh.ee.........eehhhhhhhhhhhhhhh..eee...eeeee.....eeeee....eeeeeeeee...eee......hhhhhh...ee.hhhhhh.hhhhh..eeeee..hhhhhhhhhhhh....eeeee........hhhhhhhhhh...eeee..eeeeeeee....eeeeeeee.....eeeee..eeee...eee.hhhhh......................eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4up3 B   3 NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSASAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVQDRVYRQAIVAAGSGCMAALSCEKWLQTH 314
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4UP3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4UP3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4UP3)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:96 - Pro A:97   [ RasMol ]  
    Gln B:96 - Pro B:97   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4up3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C4LW95_ENTHI | C4LW95
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.8.1.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C4LW95_ENTHI | C4LW95
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        C4LW95_ENTHI | C4LW95: 4a5l 4a65 4cbq 4ccq 4ccr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4UP3)