|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6) Biological Unit 1 (2, 3) Biological Unit 2 (1, 1) Biological Unit 3 (1, 1) Biological Unit 4 (1, 1) |
Asymmetric Unit (6, 6)
|
(no "SS Bond" information available for 3ZOO) |
(no "Cis Peptide Bond" information available for 3ZOO) |
Asymmetric Unit (3, 12)
|
Asymmetric Unit (1, 4)
|
Asymmetric Unit (2, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 CYC_HUMAN 2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 SCOP domains d3zooa_ A: Mitochondrial cytochrome c SCOP domains CATH domains -------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: A:1-102 UniProt: 2-103 -- PROSITE Transcript 1 (1) Exon 1.3 PDB: A:1-56 UniProt: 1-57 [INCOMPLETE] ------------------------------------------------ Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------Exon 1.4d PDB: A:56-104 UniProt: 57-105 Transcript 1 (2) 3zoo A 1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:104 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 CYC_HUMAN 2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 SCOP domains d3zoob_ B: Mitochondrial cytochrome c SCOP domains CATH domains -------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: B:1-102 UniProt: 2-103 -- PROSITE Transcript 1 (1) Exon 1.3 PDB: B:1-56 UniProt: 1-57 [INCOMPLETE] ------------------------------------------------ Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------Exon 1.4d PDB: B:56-104 UniProt: 57-105 Transcript 1 (2) 3zoo B 1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104 10 20 30 40 50 60 70 80 90 100 Chain C from PDB Type:PROTEIN Length:104 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 CYC_HUMAN 2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 SCOP domains d3zooc_ C: Mitochondrial cytochrome c SCOP domains CATH domains -------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: C:1-102 UniProt: 2-103 -- PROSITE Transcript 1 (1) Exon 1.3 PDB: C:1-56 UniProt: 1-57 [INCOMPLETE] ------------------------------------------------ Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------Exon 1.4d PDB: C:56-104 UniProt: 57-105 Transcript 1 (2) 3zoo C 1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104 10 20 30 40 50 60 70 80 90 100 Chain D from PDB Type:PROTEIN Length:104 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 CYC_HUMAN 2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105 SCOP domains d3zood_ D: Mitochondrial cytochrome c SCOP domains CATH domains -------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: D:1-102 UniProt: 2-103 -- PROSITE Transcript 1 (1) Exon 1.3 PDB: D:1-56 UniProt: 1-57 [INCOMPLETE] ------------------------------------------------ Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------Exon 1.4d PDB: D:56-104 UniProt: 57-105 Transcript 1 (2) 3zoo D 1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104 10 20 30 40 50 60 70 80 90 100
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3ZOO) |
(no "Pfam Domain" information available for 3ZOO) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (CYC_HUMAN | P99999)
|
|
|
|
|
|
|