3ZOO - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   STRUCTURE OF THE Y46F MUTANT OF HUMAN CYTOCHROME C

Authors :   B. S. Rajagopal, J. A. R. Worrall, M. A. Hough

Date :   22 Feb 13 (Deposition) - 23 Oct 13 (Release) - 11 Nov 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.35

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Oxidoreductase, Respiration, Apoptosis, Electron Transfer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. S. Rajagopal, A. N. Edzuma, M. A. Hough, K. L. I. M. Blundell, V. E. Kagan, A. A. Kapralov, L. A. Fraser, J. N. Butt, G. G. Silkstone, M. T. Wilson, D. A. Svistunenko, J. A. R. Worrall
The Hydrogen Peroxide Induced Radical Behaviour In Human Cytochrome C Phospholipid Complexes: Implications For The Enhanced Pro-Apoptotic Activity Of The G41S Mutant
Biochem. J. V. 456 441 2013
PubMed-ID: 24099549 | Reference-DOI: 10.1042/BJ20130758

Molecule 1 - CYTOCHROME C
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	HEC	4	Ligand/Ion	HEME C
2	PO4	2	Ligand/Ion	PHOSPHATE ION

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	HEC	1	Ligand/Ion	HEME C
2	PO4	2	Ligand/Ion	PHOSPHATE ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	HEC	1	Ligand/Ion	HEME C
2	PO4	-1	Ligand/Ion	PHOSPHATE ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	HEC	1	Ligand/Ion	HEME C
2	PO4	-1	Ligand/Ion	PHOSPHATE ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	HEC	1	Ligand/Ion	HEME C
2	PO4	-1	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:13 , CYS A:14 , CYS A:17 , HIS A:18 , THR A:28 , PRO A:30 , THR A:40 , GLY A:41 , TYR A:48 , THR A:49 , ASN A:52 , TRP A:59 , TYR A:67 , LEU A:68 , THR A:78 , LYS A:79 , MET A:80 , PHE A:82 , HOH A:2070 , LYS B:55	BINDING SITE FOR RESIDUE HEM A 105
2	AC2	SOFTWARE	LYS B:13 , CYS B:14 , CYS B:17 , HIS B:18 , THR B:28 , GLY B:29 , PRO B:30 , THR B:40 , GLY B:41 , TYR B:48 , THR B:49 , ASN B:52 , TRP B:59 , TYR B:67 , THR B:78 , LYS B:79 , MET B:80 , PHE B:82 , HOH B:2030 , HOH B:2034	BINDING SITE FOR RESIDUE HEM B 105
3	AC3	SOFTWARE	LYS C:13 , CYS C:14 , CYS C:17 , HIS C:18 , THR C:28 , PRO C:30 , THR C:40 , GLY C:41 , TYR C:48 , THR C:49 , ASN C:52 , TRP C:59 , TYR C:67 , LEU C:68 , THR C:78 , LYS C:79 , MET C:80 , PHE C:82 , HOH C:2031 , HOH C:2035 , LYS D:55	BINDING SITE FOR RESIDUE HEM C 105
4	AC4	SOFTWARE	LYS A:55 , LYS D:13 , CYS D:14 , CYS D:17 , HIS D:18 , THR D:28 , PRO D:30 , THR D:40 , GLY D:41 , TYR D:48 , THR D:49 , ASN D:52 , TRP D:59 , TYR D:67 , THR D:78 , LYS D:79 , MET D:80 , ILE D:81 , PHE D:82 , ILE D:85 , HOH D:2042	BINDING SITE FOR RESIDUE HEM D 105
5	AC5	SOFTWARE	LYS A:87 , LYS A:88 , HOH A:2087 , HOH A:2126 , HOH A:2144 , HOH A:2145 , LYS D:79	BINDING SITE FOR RESIDUE PO4 A1105
6	AC6	SOFTWARE	LYS A:13 , LYS B:73	BINDING SITE FOR RESIDUE PO4 A1106

(no "SS Bond" information available for 3ZOO)

(no "Cis Peptide Bond" information available for 3ZOO)

Asymmetric Unit (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044450	G	42	S	CYC_HUMAN	Disease (THC4)	121918552	A/B/C/D	G	41	S
2	UniProt	VAR_048850	K	56	R	CYC_HUMAN	Polymorphism	11548795	A/B/C/D	K	55	R
3	UniProt	VAR_002204	M	66	L	CYC_HUMAN	Polymorphism	---	A/B/C/D	M	65	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044450	G	42	S	CYC_HUMAN	Disease (THC4)	121918552	A	G	41	S
2	UniProt	VAR_048850	K	56	R	CYC_HUMAN	Polymorphism	11548795	A	K	55	R
3	UniProt	VAR_002204	M	66	L	CYC_HUMAN	Polymorphism	---	A	M	65	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044450	G	42	S	CYC_HUMAN	Disease (THC4)	121918552	B	G	41	S
2	UniProt	VAR_048850	K	56	R	CYC_HUMAN	Polymorphism	11548795	B	K	55	R
3	UniProt	VAR_002204	M	66	L	CYC_HUMAN	Polymorphism	---	B	M	65	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044450	G	42	S	CYC_HUMAN	Disease (THC4)	121918552	C	G	41	S
2	UniProt	VAR_048850	K	56	R	CYC_HUMAN	Polymorphism	11548795	C	K	55	R
3	UniProt	VAR_002204	M	66	L	CYC_HUMAN	Polymorphism	---	C	M	65	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044450	G	42	S	CYC_HUMAN	Disease (THC4)	121918552	D	G	41	S
2	UniProt	VAR_048850	K	56	R	CYC_HUMAN	Polymorphism	11548795	D	K	55	R
3	UniProt	VAR_002204	M	66	L	CYC_HUMAN	Polymorphism	---	D	M	65	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC_HUMAN	2-103	4	A:1-102 B:1-102 C:1-102 D:1-102

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC_HUMAN	2-103	1	A:1-102 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC_HUMAN	2-103	1	- B:1-102 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC_HUMAN	2-103	1	- - C:1-102 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC_HUMAN	2-103	1	- - - D:1-102

Asymmetric Unit (2, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000305786	1a	ENSE00001286932	chr7:25164980-25164819	162	CYC_HUMAN	-	0	0	-	-
1.3	ENST00000305786	3	ENSE00001147465	chr7:25163746-25163570	177	CYC_HUMAN	1-57	57	4	A:1-56 B:1-56 C:1-56 D:1-56	56 56 56 56
1.4d	ENST00000305786	4d	ENSE00001207041	chr7:25163468-25159710	3759	CYC_HUMAN	57-105	49	4	A:56-104 B:56-104 C:56-104 D:56-104	49 49 49 49

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:104
 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
            CYC_HUMAN     2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105
               SCOP domains d3zooa_ A: Mitochondrial cytochrome c                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: A:1-102 UniProt: 2-103                                                                     -- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-56 UniProt: 1-57 [INCOMPLETE]        ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4d  PDB: A:56-104 UniProt: 57-105          Transcript 1 (2)
                 3zoo A   1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:104
 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
            CYC_HUMAN     2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105
               SCOP domains d3zoob_ B: Mitochondrial cytochrome c                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: B:1-102 UniProt: 2-103                                                                     -- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: B:1-56 UniProt: 1-57 [INCOMPLETE]        ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4d  PDB: B:56-104 UniProt: 57-105          Transcript 1 (2)
                 3zoo B   1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104
                                    10        20        30        40        50        60        70        80        90       100

Chain C from PDB  Type:PROTEIN  Length:104
 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
            CYC_HUMAN     2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105
               SCOP domains d3zooc_ C: Mitochondrial cytochrome c                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: C:1-102 UniProt: 2-103                                                                     -- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: C:1-56 UniProt: 1-57 [INCOMPLETE]        ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4d  PDB: C:56-104 UniProt: 57-105          Transcript 1 (2)
                 3zoo C   1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104
                                    10        20        30        40        50        60        70        80        90       100

Chain D from PDB  Type:PROTEIN  Length:104
 aligned with CYC_HUMAN | P99999 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
            CYC_HUMAN     2 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105
               SCOP domains d3zood_ D: Mitochondrial cytochrome c                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------S-------------R---------L--------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: D:1-102 UniProt: 2-103                                                                     -- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: D:1-56 UniProt: 1-57 [INCOMPLETE]        ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4d  PDB: D:56-104 UniProt: 57-105          Transcript 1 (2)
                 3zoo D   1 GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cytochrome c (308)

Superfamily: Cytochrome c (308)

Family: monodomain cytochrome c (197)

Protein domain: Mitochondrial cytochrome c (81)

Human (Homo sapiens) [TaxId: 9606] (4)

1a	d3zooa_	A:
1b	d3zoob_	B:
1c	d3zooc_	C:
1d	d3zood_	D:

(no "CATH Domain" information available for 3ZOO)

(no "Pfam Domain" information available for 3ZOO)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (CYC_HUMAN | P99999)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045155	electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity	Enables the directed movement of electrons from the CoQH2-cytochrome c reductase complex and the cytochrome c oxidase complex.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
biological process
	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process and is mediated by cytochrome c.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0045333	cellular respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which either requires oxygen (aerobic respiration) or does not (anaerobic respiration).
	GO:0097193	intrinsic apoptotic signaling pathway	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway starts with reception of an intracellular signal (e.g. DNA damage, endoplasmic reticulum stress, oxidative stress etc.), and ends when the execution phase of apoptosis is triggered. The intrinsic apoptotic signaling pathway is crucially regulated by permeabilization of the mitochondrial outer membrane (MOMP).
	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	The transfer of electrons from cytochrome c to oxygen that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex IV.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0007005	mitochondrion organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0000302	response to reactive oxygen species	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a reactive oxygen species stimulus. Reactive oxygen species include singlet oxygen, superoxide, and oxygen free radicals.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0000159	protein phosphatase type 2A complex	A protein complex that has protein serine/threonine phosphatase activity that is polycation-stimulated (PCS), being directly stimulated by protamine, polylysine, or histone H1; it constitutes a subclass of several enzymes activated by different histones and polylysine, and consists of catalytic, scaffolding, and regulatory subunits. The catalytic and scaffolding subunits form the core enzyme, and the holoenzyme also includes the regulatory subunit.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3zoo)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3zoo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CYC_HUMAN \| P99999
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	612004
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CYC_HUMAN \| P99999
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CYC_HUMAN \| P99999	:	1j3s 2n3y 2n9i 2n9j 3nwv 3zcf 5exq

(no "Related Entries Specified in the PDB File" available for 3ZOO)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

PROSITE Motifs (1, 4)

Exons (2, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File