3ZLQ - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   BACE2 XAPERONE COMPLEX

Authors :   A. Kuglstatter, M. Stihle

Date :   04 Feb 13 (Deposition) - 01 May 13 (Release) - 05 Jun 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Hydrolase-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Hilpert, W. Guba, T. J. Woltering, W. Wostl, E. Pinard, H. Mauser, A. V. Mayweg, M. Rogers-Evans, R. Humm, D. Krummenacher, T. Muser, C. Schnider, H. Jacobsen, L. Ozmen, A. Bergadano, D. W. Banner, R. Hochstrasser, A. Kuglstatter, P. David-Pierson, H. Fischer, A. Polara, R. Narquizian
Beta-Secretase (Bace1) Inhibitors With High In Vivo Efficacy Suitable For Clinical Evaluation In Alzheimer'S Disease.
J. Med. Chem. V. 56 3980 2013
PubMed-ID: 23590342 | Reference-DOI: 10.1021/JM400225M

Molecule 1 - BETA-SECRETASE 2
	Chains	:	A, B
	EC Number	:	3.4.23.45
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	EXTRACELLULAR, RESIDUES 75-460
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ASPARTIC-LIKE PROTEASE 56 KDA, ASPARTYL PROTEASE 1, ASP1, ASP 1, BETA-SITE AMYLOID PRECURSOR PROTEIN CLEAVING ENZYME 2, BETA-SITE APP CLEAVING ENZYME 2, DOWN REGION ASPARTIC PROTEASE, DRAP, MEMAPSIN-1, MEMBRANE-ASSOCIATED ASPARTIC PROTEASE 1, THETA-SECRETASE, BACE2

Molecule 2 - XA4813
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PMESY4
	Expression System Taxid	:	562
	Organism Common	:	LLAMA
	Organism Scientific	:	LAMA GLAMA
	Organism Taxid	:	9844

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	6T9	2	Ligand/Ion	5-ETHOXY-PYRIDINE-2-CARBOXYLIC ACID [3-((R)-2-AMINO-5,5-DIFLUORO-4-METHYL-5,6-DIHYDRO-4H-[1,3]OXAZIN-4-YL)-4-FLUORO-PHENYL]-AMIDE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:26 , GLY A:27 , GLY A:29 , LEU A:46 , ASP A:48 , TYR A:87 , PHE A:124 , TRP A:131 , ASP A:241 , SER A:242 , GLY A:243 , THR A:245 , ALA A:347	BINDING SITE FOR RESIDUE 6T9 A1398
2	AC2	SOFTWARE	ASP B:25 , SER B:26 , GLY B:27 , ARG B:28 , GLY B:29 , ASP B:48 , TYR B:87 , PHE B:124 , TRP B:131 , ASP B:241 , SER B:242 , GLY B:243 , THR B:245 , ALA B:347	BINDING SITE FOR RESIDUE 6T9 B1398

Asymmetric/Biological Unit

No.	Residues
1	A:171	-	A:371
2	A:230	-	A:395
3	A:282	-	A:331
4	B:171	-	B:371
5	B:230	-	B:395
6	B:282	-	B:331
7	C:181	-	C:255
8	D:181	-	D:255

Asymmetric/Biological Unit

No.	Residues
1	Thr A:38	-	Pro A:39
2	Lys A:144	-	Pro A:145
3	Ala A:235	-	Asp A:236
4	Gly A:384	-	Pro A:385
5	Thr B:38	-	Pro B:39
6	Lys B:144	-	Pro B:145
7	Ala B:235	-	Asp B:236
8	Gly B:384	-	Pro B:385

(no "SAP(SNP)/Variant" information available for 3ZLQ)

Asymmetric/Biological Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	BACE2_HUMAN	92-429	2	A:30-367 B:30-367
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	BACE2_HUMAN	107-118 300-311	4	A:45-56 B:45-56 A:238-249 B:238-249

Asymmetric/Biological Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000330333	1	ENSE00001304779	chr21:42539728-42540502	775	BACE2_HUMAN	1-104	104	2	A:16-42 B:15-42	27 28
1.3a	ENST00000330333	3a	ENSE00001294412	chr21:42598193-42598281	89	BACE2_HUMAN	105-134	30	2	A:43-72 B:43-72	30 30
1.6	ENST00000330333	6	ENSE00001313528	chr21:42609440-42609656	217	BACE2_HUMAN	134-206	73	2	A:72-144 B:72-144	73 73
1.7d	ENST00000330333	7d	ENSE00001293136	chr21:42613746-42613874	129	BACE2_HUMAN	207-249	43	2	A:145-187 (gaps) B:145-187 (gaps)	43 43
1.8	ENST00000330333	8	ENSE00001315110	chr21:42615303-42615437	135	BACE2_HUMAN	250-294	45	2	A:188-232 B:188-232	45 45
1.9a	ENST00000330333	9a	ENSE00001299298	chr21:42617889-42617990	102	BACE2_HUMAN	295-328	34	2	A:233-265 B:233-266	33 34
1.10	ENST00000330333	10	ENSE00001319314	chr21:42622679-42622828	150	BACE2_HUMAN	329-378	50	2	A:272-316 B:267-316 (gaps)	45 50
1.12	ENST00000330333	12	ENSE00001297180	chr21:42629085-42629253	169	BACE2_HUMAN	379-435	57	2	A:317-373 B:317-373	57 57
1.13c	ENST00000330333	13c	ENSE00001820917	chr21:42647298-42648524	1227	BACE2_HUMAN	435-518	84	2	A:373-397 B:373-397	25 25

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:367
 aligned with BACE2_HUMAN | Q9Y5Z0 from UniProtKB/Swiss-Prot  Length:518

    Alignment length:382
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457  
          BACE2_HUMAN    78 LAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFDRAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVP 459
               SCOP domains d3zlqa_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee...eeeeeeee................................hhhhh...eeeeeeeeeee..eeeeeeeeeeeee....................................hhhhh.......hhhhhhhhhhh....eeeee....---------.eeeee...hhhhh....eeeeeee....ee.eeeeee..ee...hhhhhhh..eee......eeeehhhhhhhhhhhhhhh------.......eeeeee...hhhhhh..eeeeee.....eeeeeeehhhhheee.......eeeeee.eeee...eeehhhhhh.eeeeee....eeeeee....ee..ee.eeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------PEPTIDASE_A1  PDB: A:30-367 UniProt: 92-429                                                                                                                                                                                                                                                                                                       ------------------------------ PROSITE (1)
                PROSITE (2) -----------------------------ASP_PROTEASE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:16-42     Exon 1.3a  PDB: A:43-72       ------------------------------------------------------------------------Exon 1.7d  PDB: A:145-187 (gaps)           Exon 1.8  PDB: A:188-232 UniProt: 250-294    Exon 1.9a  PDB: A:233-265         Exon 1.10  PDB: A:272-316 UniProt: 329-378        Exon 1.12  PDB: A:317-373 UniProt: 379-435               ------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.6  PDB: A:72-144 UniProt: 134-206                                 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13c  PDB: A:373-39 Transcript 1 (2)
                 3zlq A  16 LAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAG---------GGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARAS------DGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFDRAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVP 397
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165        |-       185       195       205       215       225       235       245       255       265      |275       285       295       305       315       325       335       345       355       365       375       385       395  
                                                                                                                                                                                        174       184                                                                              265    272

Chain B from PDB  Type:PROTEIN  Length:370
 aligned with BACE2_HUMAN | Q9Y5Z0 from UniProtKB/Swiss-Prot  Length:518

    Alignment length:383
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456   
          BACE2_HUMAN    77 FLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFDRAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVP 459
               SCOP domains d3zlqb_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..eeee...eeeeeeee................................hhhhh...eeeeeeeeee....eeeeeeeeeeee....................................hhhhh.......hhhhhhhhhhh...eeeeee....---------.eeeee...hhhhheeeeeeeeeee....ee.eeeeee..ee...hhhhhh...eee......eeeehhhhhhhhhhhhhh...----.......eeeeee.hhhhhhh...eeeeee.....eeeeeeehhhhheee.......eeeeee.eeee...eeehhhhhh.eeeeee....eeeeee....ee..ee.eeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------PEPTIDASE_A1  PDB: B:30-367 UniProt: 92-429                                                                                                                                                                                                                                                                                                       ------------------------------ PROSITE (1)
                PROSITE (2) ------------------------------ASP_PROTEASE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: B:15-42      Exon 1.3a  PDB: B:43-72       ------------------------------------------------------------------------Exon 1.7d  PDB: B:145-187 (gaps)           Exon 1.8  PDB: B:188-232 UniProt: 250-294    Exon 1.9a  PDB: B:233-266         Exon 1.10  PDB: B:267-316 (gaps) UniProt: 329-378 Exon 1.12  PDB: B:317-373 UniProt: 379-435               ------------------------ Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.6  PDB: B:72-144 UniProt: 134-206                                 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13c  PDB: B:373-39 Transcript 1 (2)
                 3zlq B  15 FLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAG---------GGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLI----DGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFDRAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVP 397
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264  |    274       284       294       304       314       324       334       344       354       364       374       384       394   
                                                                                                                                                                                         174       184                                                                                267  272

Chain C from PDB  Type:PROTEIN  Length:112
                                                                                                                                                
               SCOP domains d3zlqc_ C: automated matches                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee..hhhhh.eeeeee......eeeeee......eee.hhhh..eeeeeehhh.eeeeee...hhhhheeeeeee..ee...eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 3zlq C 160 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS 271
                                   169       179       189       199       209       219       229       239       249       259       269

Chain D from PDB  Type:PROTEIN  Length:112
                                                                                                                                                
               SCOP domains d3zlqd_ D: automated matches                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhhh..eeeeeehhh.eeeeee...hhhhheeeeeee..ee...eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 3zlq D 160 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS 271
                                   169       179       189       199       209       219       229       239       249       259       269

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Acid proteases (1120)

Superfamily: Acid proteases (1120)

Family: automated matches (23)

Protein domain: automated matches (23)

Human (Homo sapiens) [TaxId: 9606] (12)

1a	d3zlqa_	A:
1b	d3zlqb_	B:

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: Immunoglobulin (5995)

Family: V set domains (antibody variable domain-like) (1919)

Protein domain: automated matches (311)

Llama (Lama glama) [TaxId: 9844] (62)

2a	d3zlqc_	C:
2b	d3zlqd_	D:

(no "CATH Domain" information available for 3ZLQ)

(no "Pfam Domain" information available for 3ZLQ)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (BACE2_HUMAN | Q9Y5Z0)

molecular function
	GO:0001540	amyloid-beta binding	Interacting selectively and non-covalently with amyloid-beta peptide/protein and/or its precursor.
	GO:0004190	aspartic-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
	GO:0050435	amyloid-beta metabolic process	The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
	GO:0006509	membrane protein ectodomain proteolysis	The proteolytic cleavage of transmembrane proteins and release of their ectodomain (extracellular domain).
	GO:0042985	negative regulation of amyloid precursor protein biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of amyloid precursor protein (APP), the precursor of amyloid-beta.
	GO:0016486	peptide hormone processing	The generation of a mature peptide hormone by posttranslational processing of a prohormone.
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		6T9	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:235 - Asp A:236	[ RasMol ]
		Ala B:235 - Asp B:236	[ RasMol ]
		Gly A:384 - Pro A:385	[ RasMol ]
		Gly B:384 - Pro B:385	[ RasMol ]
		Lys A:144 - Pro A:145	[ RasMol ]
		Lys B:144 - Pro B:145	[ RasMol ]
		Thr A:38 - Pro A:39	[ RasMol ]
		Thr B:38 - Pro B:39	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3zlq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BACE2_HUMAN \| Q9Y5Z0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.23.45
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BACE2_HUMAN \| Q9Y5Z0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	BACE2_HUMAN \| Q9Y5Z0	:	2ewy 3zkg 3zki 3zkm 3zkn 3zkq 3zks 3zkx 3zl7 4bel 4bfb

(no "Related Entries Specified in the PDB File" available for 3ZLQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (8, 8)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File